DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302C1 and UGT71B1

DIOPT Version :10

Sequence 1:NP_652626.1 Gene:Ugt302C1 / 53510 FlyBaseID:FBgn0040259 Length:528 Species:Drosophila melanogaster
Sequence 2:NP_188812.1 Gene:UGT71B1 / 821729 AraportID:AT3G21750 Length:473 Species:Arabidopsis thaliana


Alignment Length:151 Identity:29/151 - (19%)
Similarity:55/151 - (36%) Gaps:38/151 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TILIDWFSDAVREYIFRNEAVHLAVSL-----VDRALPMFNINKMRFQLVGITSMRIAVKYEEIF 62
            :|::|.|....:..:...|...::|:.     :...|||.....:...||.:..:...::|:.|.
plant   431 SIIVDIFHGLFKSTLVCPECSKISVTFDPFCYLTLPLPMKKERALEVYLVRMDPLAKPMQYKVIV 495

  Fly    63 PPI-----LSNTRHSFDGAI--------LYWKVRLHR-----RNAHTILDRIMLCTENELY---- 105
            |.|     |.....|..|..        :| ..|.||     .|..:|::|      :::|    
plant   496 PKIGNIMDLCTALSSLSGIAPEKMVVTDIY-NHRFHRIFAMDENLSSIMER------DDIYVFET 553

  Fly   106 ----KKDAECCQTPRAVADRF 122
                .:|.|....|..:.::|
plant   554 SINRTEDTEQVIIPVYLREKF 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302C1NP_652626.1 Glycosyltransferase_GTB-type <185..507 CDD:471961
UGT71B1NP_188812.1 Glycosyltransferase_GTB-type 1..473 CDD:471961 8/41 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.