DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302C1 and AT3G02100

DIOPT Version :9

Sequence 1:NP_652626.1 Gene:Ugt302C1 / 53510 FlyBaseID:FBgn0040259 Length:528 Species:Drosophila melanogaster
Sequence 2:NP_186859.1 Gene:AT3G02100 / 820287 AraportID:AT3G02100 Length:464 Species:Arabidopsis thaliana


Alignment Length:423 Identity:91/423 - (21%)
Similarity:166/423 - (39%) Gaps:102/423 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 YLVVLHTAARSHYHVGSALAKGLAAAGHQVTII-SPFELKKPIKNIKDVPAKSILTSMQGRIANL 90
            ::||:...|:.|.....:.::.||..|.|:|.| :.|...:.|.::.:.|.:..:    |...||
plant    13 HVVVIPYPAQGHVLPLISFSRYLAKQGIQITFINTEFNHNRIISSLPNSPHEDYV----GDQINL 73

  Fly    91 ------LQSSKE------PIIKQIINFHEMGI-EITELLLKEPS---VIELMKSNQTFDAVISEV 139
                  |:.|.|      .:.:.::.|....: |:.|.::.|.|   :|..:.::|:....| ||
plant    74 VSIPDGLEDSPEERNIPGKLSESVLRFMPKKVEELIERMMAETSGGTIISCVVADQSLGWAI-EV 137

  Fly   140 FLNEAHFGFAEHFKAP------LIG-----------LGTFGAISWNTDLVGSPSPPSYVPSALLK 187
               .|.||.......|      ::|           :.:.|.:..|..:..||..|         
plant   138 ---AAKFGIRRTAFCPAAAASMVLGFSIQKLIDDGLIDSDGTVRVNKTIQLSPGMP--------- 190

  Fly   188 FSDRMSLVERVGNQAFLTYEYIFLNYFYLPRQEVLYRKYFPNNKQDFYDMRKNTALVLLNQ-HVS 251
               :|.           |.:::::.......|:.:::....||     :..::|..:|.|. |..
plant   191 ---KME-----------TDKFVWVCLKNKESQKNIFQLMLQNN-----NSIESTDWLLCNSVHEL 236

  Fly   252 LSFPRPYSPNMIEVGGMHINRKRQ----------PLPKDILEFIEGAEHG-VIYFSMGS------ 299
            .:......||::.:|.:......:          |..:|.|::::....| |||.:.||      
plant   237 ETAAFGLGPNIVPIGPIGWAHSLEEGSTSLGSFLPHDRDCLDWLDRQIPGSVIYVAFGSFGVMGN 301

  Fly   300 -NLKSKTLPLEKRQALIDTFAQLKQRVLWKFEDTDLPGKPAN--VFISDWFPQDDILAHDNVLAF 361
             .|:...:.||          ..|:.|||...|.. |.|..:  |.:..|.||.::|:...:..|
plant   302 PQLEELAIGLE----------LTKRPVLWVTGDQQ-PIKLGSDRVKVVRWAPQREVLSSGAIGCF 355

  Fly   362 ITHGGLLSTTESIYHRKPFVGIPIFGDQFLNMA 394
            ::|.|..||.|...:..||:.||.|.|||:|.|
plant   356 VSHCGWNSTLEGAQNGIPFLCIPYFADQFINKA 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302C1NP_652626.1 egt <117..466 CDD:223071 69/319 (22%)
AT3G02100NP_186859.1 Glycosyltransferase_GTB_type 7..444 CDD:299143 91/423 (22%)
YjiC 11..437 CDD:224732 91/423 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48043
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.150

Return to query results.
Submit another query.