DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302C1 and AT2G36970

DIOPT Version :9

Sequence 1:NP_652626.1 Gene:Ugt302C1 / 53510 FlyBaseID:FBgn0040259 Length:528 Species:Drosophila melanogaster
Sequence 2:NP_181234.1 Gene:AT2G36970 / 818271 AraportID:AT2G36970 Length:490 Species:Arabidopsis thaliana


Alignment Length:349 Identity:73/349 - (20%)
Similarity:127/349 - (36%) Gaps:80/349 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 LIGLGTFGAISWNTDLVGSPSPPSYVPSA-LLKFSDRMSLVERVGNQAFLTYEYIFLNYFYLPRQ 219
            ||..|.|.::....|::      .|||.. .::..|.||              |:.::...:...
plant   166 LISNGHFKSLDNRKDVI------DYVPGVKAIEPKDLMS--------------YLQVSDKDVDTN 210

  Fly   220 EVLYRKYFPNNKQDFYDMRK------NTALVLLNQHVSLSFPRPYSPNMIEVGGMHINRKRQP-- 276
            .|:||..|    :.|.|:::      ||...|  :..|||..:...| :..:|.:.......|  
plant   211 TVVYRILF----KAFKDVKRADFVVCNTVQEL--EPDSLSALQAKQP-VYAIGPVFSTDSVVPTS 268

  Fly   277 --LPKDILEFIEGAEHG-VIYFSMGS--NLKSKTLPLEKRQALIDTFAQLKQRVLWKFEDTDLPG 336
              ...|..|:::|...| |:|.|.||  ::..|.:.......|:...:     .:|... .|:.|
plant   269 LWAESDCTEWLKGRPTGSVLYVSFGSYAHVGKKEIVEIAHGLLLSGIS-----FIWVLR-PDIVG 327

  Fly   337 K------PANV--------FISDWFPQDDILAHDNVLAFITHGGLLSTTESIYHRKPFVGIPIFG 387
            .      ||..        .:..|..|.:::::..|..|.||.|..|..||::...|.:..|:..
plant   328 SNVPDFLPAGFVDQAQDRGLVVQWCCQMEVISNPAVGGFFTHCGWNSILESVWCGLPLLCYPLLT 392

  Fly   388 DQFLNMARAEQNG-YGVTVHYEELSSAKLLAAIQKIINNPEATQRVRDMSDRYRDQQQTPLERAV 451
            |||.|......:. .|:.:..::..:...::|..|.:.|.|.:..:|:.                
plant   393 DQFTNRKLVVDDWCIGINLCEKKTITRDQVSANVKRLMNGETSSELRNN---------------- 441

  Fly   452 YWVEHVSRHKGAKYLRSASQDLNF 475
              ||.|.||.........|.:.||
plant   442 --VEKVKRHLKDAVTTVGSSETNF 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302C1NP_652626.1 egt <117..466 CDD:223071 70/338 (21%)
AT2G36970NP_181234.1 Glycosyltransferase_GTB_type 1..470 CDD:299143 73/349 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.