DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302C1 and UGT87A2

DIOPT Version :9

Sequence 1:NP_652626.1 Gene:Ugt302C1 / 53510 FlyBaseID:FBgn0040259 Length:528 Species:Drosophila melanogaster
Sequence 2:NP_180575.1 Gene:UGT87A2 / 817566 AraportID:AT2G30140 Length:455 Species:Arabidopsis thaliana


Alignment Length:214 Identity:58/214 - (27%)
Similarity:91/214 - (42%) Gaps:24/214 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 NRKRQPLPKDILEFIEGAEHG-VIYFSMGSNLKSKTLPLEKRQALIDTFAQLKQRVLWKFEDTDL 334
            |..::|   :.::::|....| |:|.|.||.|......:|:   ::....:...|.||.....:|
plant   252 NDNKEP---NYIQWLEEQPEGSVLYISQGSFLSVSEAQMEE---IVKGLRESGVRFLWVARGGEL 310

  Fly   335 PGKPA-----NVFISDWFPQDDILAHDNVLAFITHGGLLSTTESIYHRKPFVGIPIFGDQFLNMA 394
            ..|.|     .|.:| |..|..:|.|..|..|.||.|..||.|.||...|.:..|:|.||.|| |
plant   311 KLKEALEGSLGVVVS-WCDQLRVLCHKAVGGFWTHCGFNSTLEGIYSGVPMLAFPLFWDQILN-A 373

  Fly   395 RAEQNGYGVTVHYEELSSAKLLAAIQKIINNPEATQRVRDMSDRYRDQQQTPLERAVYWVEHVSR 459
            :.....:.|.:..|.....:||      |...|..:.|:...|| ..::...:.|....:..:||
plant   374 KMIVEDWRVGMRIERTKKNELL------IGREEIKEVVKRFMDR-ESEEGKEMRRRACDLSEISR 431

  Fly   460 HKGAKYLRSASQDLNFIQY 478
            ...||   |.|.::|..::
plant   432 GAVAK---SGSSNVNIDEF 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302C1NP_652626.1 egt <117..466 CDD:223071 55/200 (28%)
UGT87A2NP_180575.1 PLN02448 2..455 CDD:215247 58/214 (27%)
YjiC 13..450 CDD:224732 58/214 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.