DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302C1 and T19H12.12

DIOPT Version :9

Sequence 1:NP_652626.1 Gene:Ugt302C1 / 53510 FlyBaseID:FBgn0040259 Length:528 Species:Drosophila melanogaster
Sequence 2:NP_001024147.2 Gene:T19H12.12 / 3565072 WormBaseID:WBGene00044282 Length:153 Species:Caenorhabditis elegans


Alignment Length:202 Identity:41/202 - (20%)
Similarity:75/202 - (37%) Gaps:72/202 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FLALLLF-CLLSCVSAYNYLVVLHTAARSHYHVGSALAKGLAAAGHQVTIISPFELKKPIKNIKD 73
            ||::|.| |..|.:..:|.:.     ..||....|.:|..:|..||.||:..|:.:  .:||:..
 Worm     8 FLSILFFKCHSSKILIFNPIY-----GFSHVKFISKVADIIADHGHHVTLFQPYHI--ALKNLDG 65

  Fly    74 -VPAKSILTSMQGRIANLLQSSKEPIIKQIINFHEMGIEITELLLKEPSVIELMKSNQTFDAVIS 137
             |..|:|                     :|:|:|....|  |||..||         |.|     
 Worm    66 LVKNKNI---------------------EILNYHPTHYE--ELLKAEP---------QAF----- 93

  Fly   138 EVFLNEAHFGFAEHFKAPLIGLGTFGAISWNTDLVGSPSPPSYVPSALLKFSDRMSLVERVGNQA 202
                                      :..|::.|||:|...:::...|:....:::.:|.:.::.
 Worm    94 --------------------------SFFWDSHLVGNPVIGAFLMPKLIGGEFKITAMEVLSDRN 132

  Fly   203 FLTYEYI 209
            .|..:::
 Worm   133 MLKLQFV 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302C1NP_652626.1 egt <117..466 CDD:223071 12/93 (13%)
T19H12.12NP_001024147.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.