Sequence 1: | NP_652626.1 | Gene: | Ugt302C1 / 53510 | FlyBaseID: | FBgn0040259 | Length: | 528 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001024147.2 | Gene: | T19H12.12 / 3565072 | WormBaseID: | WBGene00044282 | Length: | 153 | Species: | Caenorhabditis elegans |
Alignment Length: | 202 | Identity: | 41/202 - (20%) |
---|---|---|---|
Similarity: | 75/202 - (37%) | Gaps: | 72/202 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 FLALLLF-CLLSCVSAYNYLVVLHTAARSHYHVGSALAKGLAAAGHQVTIISPFELKKPIKNIKD 73
Fly 74 -VPAKSILTSMQGRIANLLQSSKEPIIKQIINFHEMGIEITELLLKEPSVIELMKSNQTFDAVIS 137
Fly 138 EVFLNEAHFGFAEHFKAPLIGLGTFGAISWNTDLVGSPSPPSYVPSALLKFSDRMSLVERVGNQA 202
Fly 203 FLTYEYI 209 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ugt302C1 | NP_652626.1 | egt | <117..466 | CDD:223071 | 12/93 (13%) |
T19H12.12 | NP_001024147.2 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000004 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_100052 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.900 |