DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302E1 and AT1G01390

DIOPT Version :9

Sequence 1:NP_652625.2 Gene:Ugt302E1 / 53508 FlyBaseID:FBgn0040257 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001322773.1 Gene:AT1G01390 / 837790 AraportID:AT1G01390 Length:497 Species:Arabidopsis thaliana


Alignment Length:268 Identity:67/268 - (25%)
Similarity:111/268 - (41%) Gaps:52/268 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 RHEALYRKYFPNNKQDFYRMRKDTSLVLLNNHV--------SISNPRPYSPNMIEVGGMHVNRKA 271
            |::..|:....|.|:     .|:...:|:|:.|        ::..|.|..|.:..:|.: ||..:
plant   206 RNDDAYKLLLHNTKR-----YKEAKGILVNSFVDLESNAIKALQEPAPDKPTVYPIGPL-VNTSS 264

  Fly   272 PKPLPQNIR---KF-----IEEAEHG-VIYFSLGS--NLNSKDLPE------NKRKAIVETLRGL 319
                 .|:.   ||     ::....| |:|.|.||  .|..:...|      ...|..:..:|..
plant   265 -----SNVNLEDKFGCLSWLDNQPFGSVLYISFGSGGTLTCEQFNELAIGLAESGKRFIWVIRSP 324

  Fly   320 KYRVIWKY---EEET---------FVD--KPDNVLISNWLPQDDILAHEKVIAFITHGGLLSTME 370
            ...|...|   ..||         |:|  |...:::.:|.||..||||.....|:||.|..||:|
plant   325 SEIVSSSYFNPHSETDPFSFLPIGFLDRTKEKGLVVPSWAPQVQILAHPSTCGFLTHCGWNSTLE 389

  Fly   371 SIYHGKPVVGIPFFGDQFMN-MARAEQMGYGITVKYAQLTASLFRSAIERITSDPSFTERVKVIS 434
            ||.:|.|::..|.|.:|.|| :...|.:|..:.: :|.....:.|..:.|:.......|..|.|.
plant   390 SIVNGVPLIAWPLFAEQKMNTLLLVEDVGAALRI-HAGEDGIVRREEVVRVVKALMEGEEGKAIG 453

  Fly   435 SQYRDQKE 442
            ::.::.||
plant   454 NKVKELKE 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302E1NP_652625.2 egt <114..464 CDD:223071 67/268 (25%)
AT1G01390NP_001322773.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.