DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302E1 and UGT75B1

DIOPT Version :9

Sequence 1:NP_652625.2 Gene:Ugt302E1 / 53508 FlyBaseID:FBgn0040257 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001320882.1 Gene:UGT75B1 / 837058 AraportID:AT1G05560 Length:519 Species:Arabidopsis thaliana


Alignment Length:260 Identity:68/260 - (26%)
Similarity:101/260 - (38%) Gaps:76/260 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 LGFQIYEFAY---ENLINLPRHEALYRKYFPN-------NK---QDFYRMR----KDTSLVLLNN 245
            |.|.||...:   :::..||...:|..:..|:       ||   ..|..|.    |:|...:|.|
plant   189 LVFNIYYTHFMGNKSVFELPNLSSLEIRDLPSFLTPSNTNKGAYDAFQEMMEFLIKETKPKILIN 253

  Fly   246 HVSISNPRPYS--PN--MIEVGGMHVNRKAPKPLPQNI-----RKFIEE------------AEHG 289
            ......|...:  ||  |:.||.:         ||..|     .|.:::            .|..
plant   254 TFDSLEPEALTAFPNIDMVAVGPL---------LPTEIFSGSTNKSVKDQSSSYTLWLDSKTESS 309

  Fly   290 VIYFSLGSNLNSKDLPENKRKAIVETLRGL---KYRVIW------------KYEEETFVDK---- 335
            |||.|.|:      :.|..:|.|.|..|.|   |...:|            :.||||.::|    
plant   310 VIYVSFGT------MVELSKKQIEELARALIEGKRPFLWVITDKSNRETKTEGEEETEIEKIAGF 368

  Fly   336 ----PDNVLISNWLPQDDILAHEKVIAFITHGGLLSTMESIYHGKPVVGIPFFGDQFMNMARAEQ 396
                .:..:|.:|..|.::|:|..|..|:||.|..||:||:..|.|||..|.:.||..|....|:
plant   369 RHELEEVGMIVSWCSQIEVLSHRAVGCFVTHCGWSSTLESLVLGVPVVAFPMWSDQPTNAKLLEE 433

  Fly   397  396
            plant   434  433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302E1NP_652625.2 egt <114..464 CDD:223071 68/260 (26%)
UGT75B1NP_001320882.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.