DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302E1 and UGT75B2

DIOPT Version :9

Sequence 1:NP_652625.2 Gene:Ugt302E1 / 53508 FlyBaseID:FBgn0040257 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_172044.1 Gene:UGT75B2 / 837055 AraportID:AT1G05530 Length:455 Species:Arabidopsis thaliana


Alignment Length:338 Identity:76/338 - (22%)
Similarity:135/338 - (39%) Gaps:85/338 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 PSYVPHSLLRFG-DRMNFWERAQNLGFQIY---------EFAYENLINL----------PRH--- 216
            |::||....||. ..::.|.:.. ..|.||         .|.:.||.:|          |.:   
plant   116 PNWVPKVARRFHLPSVHLWIQPA-FAFDIYYNYSTGNNSVFEFPNLPSLEIRDLPSFLSPSNTNK 179

  Fly   217 --EALYRKYFPNNKQDFYRMRKDTSLVLLNNHVSISNPRPYS--PN--MIEVGGM-----HVNRK 270
              :|:|::.     .||  ::::::..:|.|......|...:  ||  |:.||.:     ....:
plant   180 AAQAVYQEL-----MDF--LKEESNPKILVNTFDSLEPEFLTAIPNIEMVAVGPLLPAEIFTGSE 237

  Fly   271 APKPLPQNIRK------FIEEAEHGVIYFSLGS--NLNSKDLPENKRKAIVETLRGLKYRVIWKY 327
            :.|.|.::.:.      ...:.|..|||.|.|:  .|:.|.:.|..| |::|..|...:.:..|.
plant   238 SGKDLSRDHQSSSYTLWLDSKTESSVIYVSFGTMVELSKKQIEELAR-ALIEGGRPFLWVITDKL 301

  Fly   328 --------EEETFVDK--------PDNVLISNWLPQDDILAHEKVIAFITHGGLLSTMESIYHGK 376
                    ||||.::|        .:..:|.:|..|.::|.|..:..|:||.|..|::||:..|.
plant   302 NREAKIEGEEETEIEKIAGFRHELEEVGMIVSWCSQIEVLRHRAIGCFLTHCGWSSSLESLVLGV 366

  Fly   377 PVVGIPFFGDQFMNMARAEQMGYGITVKYAQLTASLFRSAIERITSDPSFTERVKVIS--SQYRD 439
            |||..|.:.||..|               |:|...::::.:....:.....||.:::.  ....:
plant   367 PVVAFPMWSDQPAN---------------AKLLEEIWKTGVRVRENSEGLVERGEIMRCLEAVME 416

  Fly   440 QKETPL-ERAVYW 451
            .|...| |.|..|
plant   417 AKSVELRENAEKW 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302E1NP_652625.2 egt <114..464 CDD:223071 76/338 (22%)
UGT75B2NP_172044.1 PLN02152 1..455 CDD:177813 76/338 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.