DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302E1 and UGT72E2

DIOPT Version :9

Sequence 1:NP_652625.2 Gene:Ugt302E1 / 53508 FlyBaseID:FBgn0040257 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_201470.1 Gene:UGT72E2 / 836802 AraportID:AT5G66690 Length:481 Species:Arabidopsis thaliana


Alignment Length:510 Identity:108/510 - (21%)
Similarity:170/510 - (33%) Gaps:185/510 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 TASKSHYAVCFALAKGLAAAGHE---------VTLVSPFPQRKPIKNIIDVETPNIITVMGV--- 82
            :|:...:...|.|....|:|..:         |.|.||     .|..::|.: .:::|.:||   
plant    30 SANNGFHVTVFVLETDAASAQSKFLNSTGVDIVKLPSP-----DIYGLVDPD-DHVVTKIGVIMR 88

  Fly    83 -----YKARILENAKKPVLLRYPRISLMGLDITESLLKEPKVQE--LLKQNRTFDGVI-----CE 135
                 .:::|....:||..|   .:.|.|.|.. .|.||..:..  .:..|..|.||.     .:
plant    89 AAVPALRSKIAAMHQKPTAL---IVDLFGTDAL-CLAKEFNMLSYVFIPTNARFLGVSIYYPNLD 149

  Fly   136 TFMNDAHYGFAEHFGAPLITLSSLGATGW-------TSDLVGTPSPPSY---VPHSLL---RFGD 187
            ..:.:.|          .:..:.|...|.       |.|....|..|.|   |.|.|.   ..|.
plant   150 KDIKEEH----------TVQRNPLAIPGCEPVRFEDTLDAYLVPDEPVYRDFVRHGLAYPKADGI 204

  Fly   188 RMNFWERAQNLGFQIYEFAYENLINLPRHEALYRKYFPNNKQDFYRMRKDTSLVLLNNHVSISNP 252
            .:|.||..:                            |.:.:                  |:.||
plant   205 LVNTWEEME----------------------------PKSLK------------------SLLNP 223

  Fly   253 R--------PYSPNMIEVGGMHVNRKAPKPLPQNIRKFIEEAEH------------GVIYFSLGS 297
            :        |..|    :|          ||.:.|:.  .|.:|            .|:|.|.||
plant   224 KLLGRVARVPVYP----IG----------PLCRPIQS--SETDHPVLDWLNEQPNESVLYISFGS 272

  Fly   298 N--LNSKDLPENKRKAIVETLRGLKYRVIW---------------------------KYEEETFV 333
            .  |::|.|.|     :...|...:.|.:|                           :|..|.||
plant   273 GGCLSAKQLTE-----LAWGLEQSQQRFVWVVRPPVDGSCCSEYVSANGGGTEDNTPEYLPEGFV 332

  Fly   334 DKPDN--VLISNWLPQDDILAHEKVIAFITHGGLLSTMESIYHGKPVVGIPFFGDQFMNMA-RAE 395
            .:..:  .::.:|.||.:||:|..|..|:||.|..||:||:..|.|::..|.|.:|.||.| .::
plant   333 SRTSDRGFVVPSWAPQAEILSHRAVGGFLTHCGWSSTLESVVGGVPMIAWPLFAEQNMNAALLSD 397

  Fly   396 QMGYGITVKYAQLTASLFRSAIERI-----TSDPSFTERVKVISSQYRDQKETPL 445
            ::  ||.|:.......:.|..||.:     |.......|.||  .:.||..|..|
plant   398 EL--GIAVRLDDPKEDISRWKIEALVRKVMTEKEGEAMRRKV--KKLRDSAEMSL 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302E1NP_652625.2 egt <114..464 CDD:223071 86/409 (21%)
UGT72E2NP_201470.1 PLN02992 1..481 CDD:178572 108/510 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.