DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302E1 and AT5G53990

DIOPT Version :9

Sequence 1:NP_652625.2 Gene:Ugt302E1 / 53508 FlyBaseID:FBgn0040257 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_200210.1 Gene:AT5G53990 / 835482 AraportID:AT5G53990 Length:447 Species:Arabidopsis thaliana


Alignment Length:424 Identity:93/424 - (21%)
Similarity:150/424 - (35%) Gaps:115/424 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 HYAVCFALAKGLAAAGHEVTLVSP------------FPQRKPIKNI----ID-----VETPNIIT 78
            |......||..|||.||.||.:.|            ||.|....::    :|     .||.:.|.
plant    17 HMTPYLHLANKLAAKGHRVTFLLPKKAQKQLEHHNLFPDRIIFHSLTIPHVDGLPAGAETASDIP 81

  Fly    79 V-MGVYKARILENAKKPV--LLRYPRISLMGLDI---TESLLKEPKVQELLKQNRTFDGVICETF 137
            : :|.:....::..:..|  .:|..|..|:..|.   ...:.||.:|:.::              
plant    82 ISLGKFLTAAMDLTRDQVEAAVRALRPDLIFFDTAYWVPEMAKEHRVKSVI-------------- 132

  Fly   138 MNDAHYGFAEHFGAPLITLSSLGATGWTSDLVGTPSPPSYVPHSLLRFGDRMNFWERAQNLGFQI 202
                      :|   :|:.:|:.........:|.| ||.|....:|..|.     :....|.|.|
plant   133 ----------YF---VISANSIAHELVPGGELGVP-PPGYPSSKVLYRGH-----DAHALLTFSI 178

  Fly   203 YEFAYENLINLPRHEALYRKYFPNNKQDFYRMR---KDTSLVLLNNHVSISN------PRPYSPN 258
            :   ||.|                    .||:.   |:...:.:.....|..      .|.|...
plant   179 F---YERL--------------------HYRITTGLKNCDFISIRTCKEIEGKFCDYIERQYQRK 220

  Fly   259 MIEVGGMHVNRKAPKPLPQNIRKFIEEAEHG-VIYFSLGSNLN-SKDLPENKRKAIVETLRGLKY 321
            ::..|.|.......:||......::.:.:.| |||.:|||.:. .||  :.:...:...|.||.:
plant   221 VLLTGPMLPEPDNSRPLEDRWNHWLNQFKPGSVIYCALGSQITLEKD--QFQELCLGMELTGLPF 283

  Fly   322 RVIWK---------------YEEETFVDKPDNVLISNWLPQDDILAHEKVIAFITHGGLLSTMES 371
            .|..|               :||..   |...|:...|:.|..||||..|..|:||.|..|..||
plant   284 LVAVKPPKGAKTIQEALPEGFEERV---KNHGVVWGEWVQQPLILAHPSVGCFVTHCGFGSMWES 345

  Fly   372 IYHGKPVVGIPFFGDQFMN-MARAEQMGYGITVK 404
            :.....:|.:|:..||.:| ...:|::...:.||
plant   346 LVSDCQIVLLPYLCDQILNTRLMSEELEVSVEVK 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302E1NP_652625.2 egt <114..464 CDD:223071 69/318 (22%)
AT5G53990NP_200210.1 Glycosyltransferase_GTB-type 1..438 CDD:415824 93/424 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.