DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302E1 and AT5G37950

DIOPT Version :9

Sequence 1:NP_652625.2 Gene:Ugt302E1 / 53508 FlyBaseID:FBgn0040257 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_198611.1 Gene:AT5G37950 / 833774 AraportID:AT5G37950 Length:351 Species:Arabidopsis thaliana


Alignment Length:387 Identity:95/387 - (24%)
Similarity:150/387 - (38%) Gaps:92/387 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LAKGLAAAGHEVTLV-SPFPQRKPIKNIIDVETPNIITVMGVYKARILENAKKPVLLRYPRISLM 105
            |.:..:..|..:|:. :.|....|.|::.|.:   .||:              |..|....:..:
plant     4 LGRAHSLKGFSITVAQTKFNYLNPSKDLADFQ---FITI--------------PESLPASDLKTL 51

  Fly   106 G-LDITESLLKEPKV-------QELLKQNRTFDGVICETFMNDAHYGFAEHFGAPLITLSSLGAT 162
            | :.....|.||.::       |.||:|......||.:.||..|. ..|:.|..|.:..|:..||
plant    52 GPIWFIIKLNKECEISFKKCLGQFLLQQQEEIACVIYDEFMYFAE-AAAKEFNLPKVIFSTENAT 115

  Fly   163 GWT--SDLVGTPSPPSYVPHSLLRFGDRMNFWERAQNLGFQIYEFAYENLIN---LPRHEALYRK 222
            .:.  |.:....:.....|   |..|     ..|.:.|..:::...|::|..   .|...::  :
plant   116 AFACRSAMCKLYAKDGIAP---LTEG-----CGREEELVPELHPLRYKDLPTSAFAPVEASV--E 170

  Fly   223 YFPNNKQDFYRMRKDTSLVLLNNHVS---ISNPR--------PYSPNMIEVGGMHVNRKAPKP-- 274
            .|.::      ..|.|:..::.|.||   ||:..        |..|    :|.:::...||..  
plant   171 VFKSS------CEKGTASSMIINTVSCLEISSLEWLQQELKIPIYP----IGPLYMVSSAPPTSL 225

  Fly   275 LPQN---IRKFIEEAEHGVIYFSLGSNLNSKDLPENKRKAIVETLRGL----KYRVIWKY----- 327
            |.:|   |....::....|||.|||    |..|.|.|.  ::|...||    :| .:|..     
plant   226 LDENESCIDWLNKQKPSSVIYISLG----SFTLLETKE--VLEMASGLVSSNQY-FLWAIRPGSI 283

  Fly   328 ------EEETF--VDKPDNVLISNWLPQDDILAHEKVIAFITHGGLLSTMESIYHGKPVVGI 381
                  .||.|  ::.||...|..|..|..:|||..|.||.:|.|..||:|||..|.|:||:
plant   284 LGSELSNEELFSMMEIPDRGYIVKWATQKQVLAHAAVGAFWSHCGWNSTLESIGEGIPIVGL 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302E1NP_652625.2 egt <114..464 CDD:223071 82/313 (26%)
AT5G37950NP_198611.1 Glycosyltransferase_GTB_type 1..343 CDD:299143 93/383 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.