DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302E1 and AT5G03490

DIOPT Version :9

Sequence 1:NP_652625.2 Gene:Ugt302E1 / 53508 FlyBaseID:FBgn0040257 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_195969.1 Gene:AT5G03490 / 831823 AraportID:AT5G03490 Length:465 Species:Arabidopsis thaliana


Alignment Length:437 Identity:85/437 - (19%)
Similarity:158/437 - (36%) Gaps:144/437 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LVSPFPQRKPIKNIID--------------VETPNIITVMGVYKARILENAKKPVLLRYPRISLM 105
            :|.|||.:..:..::|              :.||..:|.:            .|:|..:|.    
plant    21 VVFPFPAQGHLLPLLDLTHQLCLRGFNVSVIVTPGNLTYL------------SPLLSAHPS---- 69

  Fly   106 GLDITESLLKEP---------------------KVQELLKQNRTFDGVICETFMNDAHYGFAEHF 149
              .:|..:...|                     .:...|:|.|       |..:|    .|..|.
plant    70 --SVTSVVFPFPPHPSLSPGVENVKDVGNSGNLPIMASLRQLR-------EPIIN----WFQSHP 121

  Fly   150 GAPLITLSSLGATGWTSDL---VGTPSPPSYVPHSLLRFGDRMNFWERAQNLGF---QIYEFAYE 208
            ..|:..:|.. ..|||.||   :|.|               |..|:    ::.|   .:.:|.:|
plant   122 NPPIALISDF-FLGWTHDLCNQIGIP---------------RFAFF----SISFFLVSVLQFCFE 166

  Fly   209 N-----------LINLPRHEALYRKYFPN--------------NKQDF------YRMRKDTSLVL 242
            |           |::|||......::.|:              :.:||      |....::|.:|
plant   167 NIDLIKSTDPIHLLDLPRAPIFKEEHLPSIVRRSLQTPSPDLESIKDFSMNLLSYGSVFNSSEIL 231

  Fly   243 LNNHVSISNPRPYSPNMIEVG-------GMHVNRKAPKPLPQNIRKFIEEAEHG-VIYFSLGSNL 299
            .::::.....|.....:..:|       |:..|..:..|   ::..:::.:.:| |:|...||  
plant   232 EDDYLQYVKQRMGHDRVYVIGPLCSIGSGLKSNSGSVDP---SLLSWLDGSPNGSVLYVCFGS-- 291

  Fly   300 NSKDLPENKRKAIVETLRGLKYRVIWKYEEETFVDKPDN------VLISNWLPQDDILAHEKVIA 358
             .|.|.:::..|:...|.....|.:|..:::...|..::      :::..|:.|..:|.|..|..
plant   292 -QKALTKDQCDALALGLEKSMTRFVWVVKKDPIPDGFEDRVSGRGLVVRGWVSQLAVLRHVAVGG 355

  Fly   359 FITHGGLLSTMESIYHGKPVVGIPFFGDQFMNMAR--AEQMGYGITV 403
            |::|.|..|.:|.|..|..::|.|...|||:| ||  .|.:|..:.|
plant   356 FLSHCGWNSVLEGITSGAVILGWPMEADQFVN-ARLLVEHLGVAVRV 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302E1NP_652625.2 egt <114..464 CDD:223071 73/364 (20%)
AT5G03490NP_195969.1 Glycosyltransferase_GTB_type 19..460 CDD:299143 85/437 (19%)
YjiC 19..447 CDD:224732 85/437 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.