DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302E1 and UGT78D2

DIOPT Version :9

Sequence 1:NP_652625.2 Gene:Ugt302E1 / 53508 FlyBaseID:FBgn0040257 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_197207.1 Gene:UGT78D2 / 831568 AraportID:AT5G17050 Length:460 Species:Arabidopsis thaliana


Alignment Length:330 Identity:79/330 - (23%)
Similarity:136/330 - (41%) Gaps:68/330 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 GVICETFMNDAHYGFAEHFGAPLIT-LSSLGATGWTSDLVGTPSPPSYVPHSLLR-------FGD 187
            |...:..|.||.:.||    |.:.| :::.....||:   |..|..:::...|:|       .|:
plant   114 GTEVKCLMTDAFFWFA----ADMATEINASWIAFWTA---GANSLSAHLYTDLIRETIGVKEVGE 171

  Fly   188 RM-------NFWERAQ-----------NLGFQIYEFAYENLINLPRHEALYRKYFPNNKQDFYRM 234
            ||       :..|:.:           ||.....:..::..:.|||..|:    |.|:.:|.   
plant   172 RMEETIGVISGMEKIRVKDTPEGVVFGNLDSVFSKMLHQMGLALPRATAV----FINSFEDL--- 229

  Fly   235 RKDTSLVLLNNHVSISNPRPYSPNMIEVGGMHVNRKAPKPL---PQNIRKFIEEAEHG-VIYFSL 295
              |.:|.        :|.|......:.:|.:.:.....:.|   |.....::|:...| |.|.|.
plant   230 --DPTLT--------NNLRSRFKRYLNIGPLGLLSSTLQQLVQDPHGCLAWMEKRSSGSVAYISF 284

  Fly   296 GSNLNSKDLPENKRKAIVETLRGLKYRVIWKYEEETFVDKPDNVL--------ISNWLPQDDILA 352
            |:.:..   |..:..||.|.|...|...:|..:|::.|..|...|        :..|.||.::|.
plant   285 GTVMTP---PPGELAAIAEGLESSKVPFVWSLKEKSLVQLPKGFLDRTREQGIVVPWAPQVELLK 346

  Fly   353 HEKVIAFITHGGLLSTMESIYHGKPVVGIPFFGDQFMNMARAEQMGY--GITVKYAQLTASLFRS 415
            ||....|:||.|..|.:||:..|.|::..||||||.:| .||.::.:  |:|:.....|...|..
plant   347 HEATGVFVTHCGWNSVLESVSGGVPMICRPFFGDQRLN-GRAVEVVWEIGMTIINGVFTKDGFEK 410

  Fly   416 AIERI 420
            .::::
plant   411 CLDKV 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302E1NP_652625.2 egt <114..464 CDD:223071 79/330 (24%)
UGT78D2NP_197207.1 GT1_Gtf-like 12..438 CDD:340817 79/330 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto3776
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.