DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302E1 and UGT78D3

DIOPT Version :9

Sequence 1:NP_652625.2 Gene:Ugt302E1 / 53508 FlyBaseID:FBgn0040257 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_197205.1 Gene:UGT78D3 / 831566 AraportID:AT5G17030 Length:459 Species:Arabidopsis thaliana


Alignment Length:444 Identity:97/444 - (21%)
Similarity:165/444 - (37%) Gaps:108/444 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 SHYAVCFALAKGLAAAGHEVTLVSPFPQRKPIKNIIDVETPNIITVM----GVYKARIL----EN 90
            :|.|...|:...||.|... |:.|.|...:...:::..:.|..|.|.    ||.:..:|    ::
plant    22 THAAPLLAVTCRLATAAPS-TVFSFFSTARSNSSLLSSDIPTNIRVHNVDDGVPEGFVLTGNPQH 85

  Fly    91 AKKPVLLRYPRISLMGLDITESLLKEPKVQELLKQNRTFDGVICETFMNDAHYGFAEHFGAPLIT 155
            |.:..|...|.|          ..:|.|..| .:..|.|..::.:.|:..|....|....|..:.
plant    86 AVELFLEAAPEI----------FRREIKAAE-TEVGRKFKCILTDAFLWLAAETAAAEMKASWVA 139

  Fly   156 LSSLGATGWTSDL--------VGTPSPPSYVPHSLLRFGDRMNFWERAQNLGF-------QIYE- 204
            ....|||..|:.|        ||           :...|:||.     :.:||       ::.: 
plant   140 YYGGGATSLTAHLYTDAIRENVG-----------VKEVGERME-----ETIGFISGMEKIRVKDT 188

  Fly   205 ---FAYENL------------INLPRHEALYRKYFP--------NNKQDFYRMRKDTSLVLLNNH 246
               ..:.||            :.|||..|::...|.        :.:.:|.|......|.||   
plant   189 QEGVVFGNLDSVFSKTLHQMGLALPRATAVFINSFEELDPTFTNDFRSEFKRYLNIGPLALL--- 250

  Fly   247 VSISNPRPYSPNMIEVGGMHVNRKAPKPLPQNIRKFIEE-AEHGVIYFSLGSNLNSKDLPENKRK 310
               |:|...|..:.:              |.....:||: :...|.|.:.|.....   |..:..
plant   251 ---SSPSQTSTLVHD--------------PHGCLAWIEKRSTASVAYIAFGRVATP---PPVELV 295

  Fly   311 AIVETLRGLKYRVIWKYEE-------ETFVDKP-DNVLISNWLPQDDILAHEKVIAFITHGGLLS 367
            ||.:.|...|...:|..:|       |.|:|:. :..::..|.||.::|.||.:..|::|||..|
plant   296 AIAQGLESSKVPFVWSLQEMKMTHLPEGFLDRTREQGMVVPWAPQVELLNHEAMGVFVSHGGWNS 360

  Fly   368 TMESIYHGKPVVGIPFFGDQFMNMARAEQM-GYGITVKYAQLTASLFRSAIERI 420
            .:||:..|.|::..|.|||..:|....|.: ..|:|:.....|...|..:::|:
plant   361 VLESVSAGVPMICRPIFGDHAINARSVEAVWEIGVTISSGVFTKDGFEESLDRV 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302E1NP_652625.2 egt <114..464 CDD:223071 78/356 (22%)
UGT78D3NP_197205.1 Glycosyltransferase_GTB_type 6..458 CDD:299143 97/444 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.