DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302E1 and AT5G05890

DIOPT Version :10

Sequence 1:NP_652625.2 Gene:Ugt302E1 / 53508 FlyBaseID:FBgn0040257 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_196208.1 Gene:AT5G05890 / 830474 AraportID:AT5G05890 Length:455 Species:Arabidopsis thaliana


Alignment Length:56 Identity:15/56 - (26%)
Similarity:23/56 - (41%) Gaps:8/56 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   665 VVQKSDLKKLFRATDFYEVVDESKVFNKVGDAVKAAEQHISSPKTTKEILTALASI 720
            :|.:..|..::....||..|....:||.|      ..||.|...||  :|:...|:
plant    89 IVHRDGLYYVYCQVGFYGKVPNIVLFNHV------IIQHDSDTVTT--LLSGTESV 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302E1NP_652625.2 Glycosyltransferase_GTB-type <170..496 CDD:471961
AT5G05890NP_196208.1 Glycosyltransferase_GTB-type 2..455 CDD:471961 15/56 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.