DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302E1 and UGT76C2

DIOPT Version :10

Sequence 1:NP_652625.2 Gene:Ugt302E1 / 53508 FlyBaseID:FBgn0040257 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_196205.1 Gene:UGT76C2 / 830471 AraportID:AT5G05860 Length:450 Species:Arabidopsis thaliana


Alignment Length:84 Identity:18/84 - (21%)
Similarity:36/84 - (42%) Gaps:17/84 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   714 LTALASI-----ATTDTVLIDEES---------SDSNDNDDAEIQERITEESENSEEVMSETSVS 764
            :||:.|:     ...|||..:...         :|:..|:...:.|::....||...:.|  .:|
plant   138 VTAVGSLPYISSVNADTVYCESCDWLPKPYLIWADNEGNNIIPLMEKVHTNKENLYCISS--IIS 200

  Fly   765 IEDATSLTSS-RNSINSEE 782
            |..|.::|.: .|::|..:
plant   201 ITAAVNITCTVSNALNQSK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302E1NP_652625.2 Glycosyltransferase_GTB-type <170..496 CDD:471961
UGT76C2NP_196205.1 Glycosyltransferase_GTB-type 1..450 CDD:471961 18/84 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.