DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302E1 and UGT73B1

DIOPT Version :9

Sequence 1:NP_652625.2 Gene:Ugt302E1 / 53508 FlyBaseID:FBgn0040257 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_567955.1 Gene:UGT73B1 / 829561 AraportID:AT4G34138 Length:488 Species:Arabidopsis thaliana


Alignment Length:453 Identity:100/453 - (22%)
Similarity:161/453 - (35%) Gaps:139/453 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 HYAVCFALAKGLAAAGHEVT-LVSPFPQR----KPIKNIIDVETPNI--ITVMGVYKARILENAK 92
            |......:||..|..|.:.| |.:|...:    ||||: .:.:.|.:  ||:.            
plant    22 HMIPTLDMAKLFATKGAKSTILTTPLNAKLFFEKPIKS-FNQDNPGLEDITIQ------------ 73

  Fly    93 KPVLLRYPRISL---MGLDITESLLKEPKV------QELLKQNRTFDGVICE---TFMNDAHYG- 144
               :|.:|...|   .|.:.|:.:...|.:      |:.|...:.|:..:.|   |...|...| 
plant    74 ---ILNFPCTELGLPDGCENTDFIFSTPDLNVGDLSQKFLLAMKYFEEPLEELLVTMRPDCLVGN 135

  Fly   145 --------FAEHFGAPLITLSSLGATGWTS----------DLVGTPSPPSYVPHSLLRFGDRMNF 191
                    .||.||.|.:...   .||:.|          ..|.|.|.|..:|...   ||.:..
plant   136 MFFPWSTKVAEKFGVPRLVFH---GTGYFSLCASHCIRLPKNVATSSEPFVIPDLP---GDILIT 194

  Fly   192 WERAQNLGFQIYEFAYENLINLPRHEALYRKYFPNNKQDFYRMRKDTSLVLLNNHVSISNP-RPY 255
            .|       |:.|...|:::      ..:.|...::::|.:.       ||:|:...:... ..|
plant   195 EE-------QVMETEEESVM------GRFMKAIRDSERDSFG-------VLVNSFYELEQAYSDY 239

  Fly   256 SPNMIEVGGMHVNRKAPKPLPQNIRKFIEEAEHG---------------------VIYFSLGSNL 299
            ..:.:.....|:.     ||....|||.|:||.|                     |||.:.|:  
plant   240 FKSFVAKRAWHIG-----PLSLGNRKFEEKAERGKKASIDEHECLKWLDSKKCDSVIYMAFGT-- 297

  Fly   300 NSKDLPENKRKAIVETLRGLK---YRVIW-----------------KYEEETFVDKPDNVLISNW 344
                :...|.:.::|...||.   :..:|                 .:||:|   |...::|..|
plant   298 ----MSSFKNEQLIEIAAGLDMSGHDFVWVVNRKGSQVEKEDWLPEGFEEKT---KGKGLIIRGW 355

  Fly   345 LPQDDILAHEKVIAFITHGGLLSTMESIYHGKPVVGIPFFGDQFMNMARAEQM---GYGITVK 404
            .||..||.|:.:..|:||.|..|.:|.:..|.|:|..|...:||.|.....|:   |..:.||
plant   356 APQVLILEHKAIGGFLTHCGWNSLLEGVAAGLPMVTWPVGAEQFYNEKLVTQVLKTGVSVGVK 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302E1NP_652625.2 egt <114..464 CDD:223071 80/364 (22%)
UGT73B1NP_567955.1 PLN03007 5..482 CDD:178584 100/453 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.