DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302E1 and UGT84A1

DIOPT Version :9

Sequence 1:NP_652625.2 Gene:Ugt302E1 / 53508 FlyBaseID:FBgn0040257 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_193283.2 Gene:UGT84A1 / 827220 AraportID:AT4G15480 Length:490 Species:Arabidopsis thaliana


Alignment Length:202 Identity:51/202 - (25%)
Similarity:82/202 - (40%) Gaps:40/202 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 IEEAEHGVIYFSLGSNLNSKDLPENKRKAIVETLRGLKYRVIWKYEEETFVDKPDNVLISNWLPQ 347
            |||..|||:...|......:..|.:.:   |||     :.:..:.:|.:...|.   :|.:|.||
plant   305 IEEIAHGVLKSGLSFLWVIRPPPHDLK---VET-----HVLPQELKESSAKGKG---MIVDWCPQ 358

  Fly   348 DDILAHEKVIAFITHGGLLSTMESIYHGKPVVGIPFFGDQFMNMARAEQMGYGITVKYAQLTASL 412
            :.:|:|..|..|:||.|..|||||:..|.|||..|.:|||               |..|.....:
plant   359 EQVLSHPSVACFVTHCGWNSTMESLSSGVPVVCCPQWGDQ---------------VTDAVYLIDV 408

  Fly   413 FRSAI--------ERITSDPSFTERVKVISSQYRDQKETPLERAVYWVEHVTRHKGAKYLRSACQ 469
            |::.:        ||:.......|  |::.:...::.|...:.|:.|.....    |........
plant   409 FKTGVRLGRGATEERVVPREEVAE--KLLEATVGEKAEELRKNALKWKAEAE----AAVAPGGSS 467

  Fly   470 DLNFIQY 476
            |.||.::
plant   468 DKNFREF 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302E1NP_652625.2 egt <114..464 CDD:223071 48/188 (26%)
UGT84A1NP_193283.2 PLN02555 17..490 CDD:178170 51/202 (25%)
YjiC 19..477 CDD:224732 51/202 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.