DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302E1 and UGT71B5

DIOPT Version :9

Sequence 1:NP_652625.2 Gene:Ugt302E1 / 53508 FlyBaseID:FBgn0040257 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001328018.1 Gene:UGT71B5 / 827194 AraportID:AT4G15280 Length:510 Species:Arabidopsis thaliana


Alignment Length:456 Identity:86/456 - (18%)
Similarity:167/456 - (36%) Gaps:91/456 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 PQRKPIKNIIDVETPNIITVM--------GVYKARI--LENAKKPVLLRYPRISL---------- 104
            |..|..|.:|..|....||::        |...|.|  |....:...|.|..||:          
plant    50 PTVKLAKQLIGSENRLSITIIIIPSRFDAGDASACIASLTTLSQDDRLHYESISVAKQPPTSDPD 114

  Fly   105 -----MGLDITESLLKEPKVQELLKQNRTFDGVICETFMNDAHYGFAEHFGAPLITLSSLGATGW 164
                 :.::..::.:::.....::...|...|.:.:.|.: :....|..||.|...:.:..||  
plant   115 PVPAQVYIEKQKTKVRDAVAARIVDPTRKLAGFVVDMFCS-SMIDVANEFGVPCYMVYTSNAT-- 176

  Fly   165 TSDLVGTPSPPSYVPHSLLRFGDRMNFWERAQNLGFQIYEFAYENLIN------LPRHEALYRKY 223
               .:||      :.|....:..:.......:|   .:.|..:.:|..      || |....:::
plant   177 ---FLGT------MLHVQQMYDQKKYDVSELEN---SVTELEFPSLTRPYPVKCLP-HILTSKEW 228

  Fly   224 FPNNKQDFYRMRKDTSLVLLNNHVSISNPRPYSPNMIEVGG------------MHVNRKAPKPLP 276
            .|.:.......||... :|:|   :::...|::..|..:.|            :|:.........
plant   229 LPLSLAQARCFRKMKG-ILVN---TVAELEPHALKMFNINGDDLPQVYPVGPVLHLENGNDDDEK 289

  Fly   277 QN--IRKFIEEAEHGVIYFSLGSNLNSKDLPENKRKAI-------------------VETLRGLK 320
            |:  :|...|:....|::...|| |......:.:..|:                   ::|.|...
plant   290 QSEILRWLDEQPSKSVVFLCFGS-LGGFTEEQTRETAVALDRSGQRFLWCLRHASPNIKTDRPRD 353

  Fly   321 YRVIWKYEEETFVDKP-DNVLISNWLPQDDILAHEKVIAFITHGGLLSTMESIYHGKPVVGIPFF 384
            |..:.:...|.|:::. |...:..|.||..:|....:..|:||.|..|.:||::.|.|:|..|.:
plant   354 YTNLEEVLPEGFLERTLDRGKVIGWAPQVAVLEKPAIGGFVTHCGWNSILESLWFGVPMVTWPLY 418

  Fly   385 GDQFMN-MARAEQMGYGITV-KYAQLTASLFRSAIERITSDPSFTERVKVISSQYRDQKETPLER 447
            .:|.:| ....|::|..:.: ||  |...||...:|.:|:: .....::.:..|..|.:....|.
plant   419 AEQKVNAFEMVEELGLAVEIRKY--LKGDLFAGEMETVTAE-DIERAIRRVMEQDSDVRNNVKEM 480

  Fly   448 A 448
            |
plant   481 A 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302E1NP_652625.2 egt <114..464 CDD:223071 71/377 (19%)
UGT71B5NP_001328018.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.