DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302E1 and AT4G14090

DIOPT Version :9

Sequence 1:NP_652625.2 Gene:Ugt302E1 / 53508 FlyBaseID:FBgn0040257 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_193146.1 Gene:AT4G14090 / 827046 AraportID:AT4G14090 Length:456 Species:Arabidopsis thaliana


Alignment Length:346 Identity:84/346 - (24%)
Similarity:139/346 - (40%) Gaps:75/346 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 ITLSSLGATGWTSDLVG-----------TPSPPSYVPHSLLRFGDRMNFW-ERAQNLGFQIYEF- 205
            |..::|.||..|..:.|           |.:...::|.:||        | |.|..|....|.| 
plant   100 IIKANLDATTETEPITGVIYSVLVPWVSTVAREFHLPTTLL--------WIEPATVLDIYYYYFN 156

  Fly   206 -AYENL-----INLPRHEALYRKYFPNNKQDFYRMRK--DTSLVLLNNHVSI----SNPR----P 254
             :|::|     |.||:...:.....|:    |.:..|  .::||.|..|:..    |||:    .
plant   157 TSYKHLFDVEPIKLPKLPLITTGDLPS----FLQPSKALPSALVTLREHIEALETESNPKILVNT 217

  Fly   255 YSP------------NMIEVGGMHVNRKAP----KPLPQNIRKFIE-EAEHGVIYFSLGSNLNSK 302
            :|.            .||.:|.:..:.:..    |...::..|::: :.|..|||.|||:  ::.
plant   218 FSALEHDALTSVEKLKMIPIGPLVSSSEGKTDLFKSSDEDYTKWLDSKLERSVIYISLGT--HAD 280

  Fly   303 DLPENKRKAIVETLRGLKYRVIWKYEEETFVDK-----------PDNVLISNWLPQDDILAHEKV 356
            ||||...:|:...:.......:|...|:...:|           .|..|:..|..|..:|||..|
plant   281 DLPEKHMEALTHGVLATNRPFLWIVREKNPEEKKKNRFLELIRGSDRGLVVGWCSQTAVLAHCAV 345

  Fly   357 IAFITHGGLLSTMESIYHGKPVVGIPFFGDQFMNMARAEQ-MGYGITVKYAQ---LTASLFRSAI 417
            ..|:||.|..||:||:..|.|||..|.|.||.......|. ...|:.||..:   :.....|..:
plant   346 GCFVTHCGWNSTLESLESGVPVVAFPQFADQCTTAKLVEDTWRIGVKVKVGEEGDVDGEEIRRCL 410

  Fly   418 ERITSDPSFTERVKVISSQYR 438
            |::.|.....|.::..:.:::
plant   411 EKVMSGGEEAEEMRENAEKWK 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302E1NP_652625.2 egt <114..464 CDD:223071 84/346 (24%)
AT4G14090NP_193146.1 YjiC 11..445 CDD:224732 84/346 (24%)
Glycosyltransferase_GTB_type 12..454 CDD:299143 84/346 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.