DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302E1 and AT3G46700

DIOPT Version :9

Sequence 1:NP_652625.2 Gene:Ugt302E1 / 53508 FlyBaseID:FBgn0040257 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_190254.2 Gene:AT3G46700 / 823823 AraportID:AT3G46700 Length:447 Species:Arabidopsis thaliana


Alignment Length:250 Identity:61/250 - (24%)
Similarity:90/250 - (36%) Gaps:83/250 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 KDTSLVLLNNHVSISNPRPYSPNMIEVGGMHVNRKAPK-PLPQNIRKFIE----EAEHGVIYFSL 295
            :.:||..|...:.|    |..|    :|.:|:...:.. .:.|..|..:|    :....|||.||
plant   211 ESSSLTRLQQELQI----PVYP----LGPLHITDSSTGFTVLQEDRSCVEWLNKQKPRSVIYISL 267

  Fly   296 GS---------------NLNS-------------------KDLPENKRKAIVETLRGLKYRVIWK 326
            ||               .|||                   :.|||...|.::|  :|        
plant   268 GSMVLMETKEMLEMAWGMLNSNQPFLWVIRPGSVSGSEGIESLPEEVSKMVLE--KG-------- 322

  Fly   327 YEEETFVDKPDNVLISNWLPQDDILAHEKVIAFITHGGLLSTMESIYHGKPVVGIPFFGDQFMNM 391
                         .|..|.||.::|.|..|..|.:|.|..||:|||..|.|::..|:.|:|.:|.
plant   323 -------------YIVKWAPQIEVLGHPSVGGFWSHCGWNSTLESIVEGVPMICRPYQGEQMLNA 374

  Fly   392 ARAEQM-GYGITVKYAQLTASLFRSAIERIT-------SDPSFTERVKVISSQYR 438
            ...|.: ..||     |:...|.|.|:||..       ...|..||..|:..:.:
plant   375 IYLESVWRIGI-----QVGGELERGAVERAVKRLIVDKEGASMRERTLVLKEKLK 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302E1NP_652625.2 egt <114..464 CDD:223071 61/249 (24%)
AT3G46700NP_190254.2 Glycosyltransferase_GTB_type 1..446 CDD:299143 61/249 (24%)
YjiC 7..426 CDD:224732 61/249 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.