DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302E1 and AT3G46690

DIOPT Version :9

Sequence 1:NP_652625.2 Gene:Ugt302E1 / 53508 FlyBaseID:FBgn0040257 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_190253.1 Gene:AT3G46690 / 823822 AraportID:AT3G46690 Length:452 Species:Arabidopsis thaliana


Alignment Length:268 Identity:70/268 - (26%)
Similarity:106/268 - (39%) Gaps:55/268 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 SLVLLNNHVSISNPRPYSPNMIEVGGMHVNRKAPKP-LPQNIRKFIE----EAEHGVIYFSLG-- 296
            ||..|...:.|    |..|    :|.:|:...:|.| |.|.....||    :....|||.|||  
plant   219 SLSWLQQELGI----PVYP----LGPLHITASSPGPSLLQEDMSCIEWLNKQKPRSVIYISLGTK 275

  Fly   297 SNLNSKDLPE------NKRKAIVETLR-----GLKYRVIWKYEEETFVDKPDNVLISNWLPQDDI 350
            :::.:|::.|      |..:..:..:|     |.::  |....||......:...|:.|.||.::
plant   276 AHMETKEMLEMAWGLLNSNQPFLWVIRPGSVAGFEW--IELLPEEVIKMVTERGYIAKWAPQIEV 338

  Fly   351 LAHEKVIAFITHGGLLSTMESIYHGKPVVGIPFFGDQFMNMARAEQM-GYGITVKYAQLTASLFR 414
            |.|..|..|.:|.|..||:|||..|.|::..|..|:|.:|....|.: ..||     ||...:.|
plant   339 LGHPAVGGFWSHCGWNSTLESIVEGVPMICRPLQGEQKLNAMYIESVWKIGI-----QLEGEVER 398

  Fly   415 SAIERITSDPSFTERVKVISSQYRDQKETPLERAVYWVEHVTRHKGAKYLRSACQDLNFIQYHNL 479
            ..:||........|....:..:..|.|| .|..:|       |..|:             .|:.|
plant   399 EGVERAVKRLIIDEEGAAMRERALDLKE-KLNASV-------RSGGS-------------SYNAL 442

  Fly   480 DVLATFFS 487
            |.|..|.:
plant   443 DELVKFLN 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302E1NP_652625.2 egt <114..464 CDD:223071 65/243 (27%)
AT3G46690NP_190253.1 Glycosyltransferase_GTB_type 1..451 CDD:299143 70/268 (26%)
YjiC 7..431 CDD:224732 62/227 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.