DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302E1 and AT3G22250

DIOPT Version :9

Sequence 1:NP_652625.2 Gene:Ugt302E1 / 53508 FlyBaseID:FBgn0040257 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_188864.1 Gene:AT3G22250 / 821795 AraportID:AT3G22250 Length:461 Species:Arabidopsis thaliana


Alignment Length:319 Identity:69/319 - (21%)
Similarity:126/319 - (39%) Gaps:80/319 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 PLITLSSLGATGWTSDLVGTPSPPSYVPHSLLRFGDRMNFW----ERAQNLGFQI---YEFAYEN 209
            ||::...|   .|   |:|||....          .|..||    ||.::|.:.:   ::..||:
plant   171 PLLSAEDL---PW---LIGTPKAQK----------KRFKFWQRTLERTKSLRWILTSSFKDEYED 219

  Fly   210 LINLPRHEALYRKYFPNNKQDFYRMRKDTSLVLLNNHVSISNPRPYSPNMIEVGGMHVNRKAPKP 274
            :.|   |:|.|:|....||:              ||        ..:|.::.:|.:| |::|...
plant   220 VDN---HKASYKKSNDLNKE--------------NN--------GQNPQILHLGPLH-NQEATNN 258

  Fly   275 LPQNIRKFIEE-----------AEHGVIYFSLGSNLNSKDLPENKRKAIVETLRGLKYRVIWK-- 326
            :......|.||           ..:.|||.|.||.::  .:.|:..:.:...|.......:|.  
plant   259 ITITKTSFWEEDMSCLGWLQEQNPNSVIYISFGSWVS--PIGESNIQTLALALEASGRPFLWALN 321

  Fly   327 ----------YEEETFVDKPDNVLISNWLPQDDILAHEKVIAFITHGGLLSTMESIYHGKPVVGI 381
                      :.....:.|....::| |.||.::|.::.|..::||.|..||||::...:.::..
plant   322 RVWQEGLPPGFVHRVTITKNQGRIVS-WAPQLEVLRNDSVGCYVTHCGWNSTMEAVASSRRLLCY 385

  Fly   382 PFFGDQFMNMARAEQMGYGITVKYAQLTASLFRSAIERITSDPSFTERVKVISSQYRDQ 440
            |..||||:|......: :.|.|:.:..........:.::..|....||::    :.||:
plant   386 PVAGDQFVNCKYIVDV-WKIGVRLSGFGEKEVEDGLRKVMEDQDMGERLR----KLRDR 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302E1NP_652625.2 egt <114..464 CDD:223071 69/319 (22%)
AT3G22250NP_188864.1 PLN02562 1..461 CDD:215305 69/319 (22%)
YjiC 6..445 CDD:224732 69/319 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48043
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.150

Return to query results.
Submit another query.