DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302E1 and UGT71B6

DIOPT Version :9

Sequence 1:NP_652625.2 Gene:Ugt302E1 / 53508 FlyBaseID:FBgn0040257 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_188815.2 Gene:UGT71B6 / 821732 AraportID:AT3G21780 Length:479 Species:Arabidopsis thaliana


Alignment Length:267 Identity:61/267 - (22%)
Similarity:102/267 - (38%) Gaps:62/267 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 SLVLLNNHVSISNPRPYSP--NMIEVGGMHVNRKAPKPLPQNIRKFIEEAEHGVIYFSLGSNLNS 301
            :|..|:|. :|....|..|  ::..|...:|::|..:.|    |...|:....|::...||    
plant   220 ALTFLSNG-NIPRAYPVGPLLHLKNVNCDYVDKKQSEIL----RWLDEQPPRSVVFLCFGS---- 275

  Fly   302 KDLPENKRKAIVETLRGLK---YRVIW------------------KYEE---ETFVDKPDN-VLI 341
              :.....:.:.||...|.   :|.:|                  ..||   |.|.|:..| ..:
plant   276 --MGGFSEEQVRETALALDRSGHRFLWSLRRASPNILREPPGEFTNLEEILPEGFFDRTANRGKV 338

  Fly   342 SNWLPQDDILAHEKVIAFITHGGLLSTMESIYHGKPVVGIPFFGDQFMN-MARAEQMGYGITVKY 405
            ..|..|..|||...:..|::|||..||:||::.|.|:...|.:.:|..| ....|::|..:.:| 
plant   339 IGWAEQVAILAKPAIGGFVSHGGWNSTLESLWFGVPMAIWPLYAEQKFNAFEMVEELGLAVEIK- 402

  Fly   406 AQLTASLFRSAIERITS-------------DPSFTERVKVISSQYR------DQKETPLERAVYW 451
            ......|.....|.:|:             |....:||..||.:..      ...||.|:|   :
plant   403 KHWRGDLLLGRSEIVTAEEIEKGIICLMEQDSDVRKRVNEISEKCHVALMDGGSSETALKR---F 464

  Fly   452 VEHVTRH 458
            ::.||.:
plant   465 IQDVTEN 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302E1NP_652625.2 egt <114..464 CDD:223071 61/267 (23%)
UGT71B6NP_188815.2 PLN02554 1..473 CDD:215304 61/267 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.