DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302E1 and HYR1

DIOPT Version :9

Sequence 1:NP_652625.2 Gene:Ugt302E1 / 53508 FlyBaseID:FBgn0040257 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_188813.1 Gene:HYR1 / 821730 AraportID:AT3G21760 Length:485 Species:Arabidopsis thaliana


Alignment Length:344 Identity:73/344 - (21%)
Similarity:125/344 - (36%) Gaps:105/344 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 PSYVPHSLLRFGDRMNFWERAQNLGFQIY-EFAYE----NLINLPRHEA---------------- 218
            |||           |.:...|..||.|:: |:.|:    ::.:|...:.                
plant   138 PSY-----------MFYTSNATFLGLQVHVEYLYDVKNYDVSDLKDSDTTELEVPCLTRPLPVKC 191

  Fly   219 -----LYRKYFPNNKQDFYRMRKDTSLVLLNNHVSISNPRPYS---------PNMIEVGGMHVNR 269
                 |.:::.|...:...|.| :|..:|:|....: .|:...         |.:..||.: :|.
plant   192 FPSVLLTKEWLPVMFRQTRRFR-ETKGILVNTFAEL-EPQAMKFFSGVDSPLPTVYTVGPV-MNL 253

  Fly   270 KAPKPLPQN------IRKFIEEAEHGVIYFSLGSNLNSKDLPENKRKAIVETLRGLKYRVIWKY- 327
            |...|...:      :|...|:....|::...||   .....|.:.|.|...|....:|.:|.. 
plant   254 KINGPNSSDDKQSEILRWLDEQPRKSVVFLCFGS---MGGFREGQAKEIAIALERSGHRFVWSLR 315

  Fly   328 -----------EEETFVDK--PDNVL--------ISNWLPQDDILAHEKVIAFITHGGLLSTMES 371
                       ||.|.:::  |:..|        |..|.||..|||:..:..|::|.|..||:||
plant   316 RAQPKGSIGPPEEFTNLEEILPEGFLERTAEIGKIVGWAPQSAILANPAIGGFVSHCGWNSTLES 380

  Fly   372 IYHGKPVVGIPFFGDQFMN-MARAEQMGYGITVKYAQLTASLFR-------------SAIER--- 419
            ::.|.|:...|.:.:|.:| ....|::|..:.|:      :.||             ..|||   
plant   381 LWFGVPMATWPLYAEQQVNAFEMVEELGLAVEVR------NSFRGDFMAADDELMTAEEIERGIR 439

  Fly   420 --ITSDPSFTERVKVISSQ 436
              :..|.....|||.:|.:
plant   440 CLMEQDSDVRSRVKEMSEK 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302E1NP_652625.2 egt <114..464 CDD:223071 73/344 (21%)
HYR1NP_188813.1 PLN02554 1..485 CDD:215304 73/344 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.