DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302E1 and UGT71B1

DIOPT Version :9

Sequence 1:NP_652625.2 Gene:Ugt302E1 / 53508 FlyBaseID:FBgn0040257 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_188812.1 Gene:UGT71B1 / 821729 AraportID:AT3G21750 Length:473 Species:Arabidopsis thaliana


Alignment Length:459 Identity:91/459 - (19%)
Similarity:151/459 - (32%) Gaps:160/459 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 HYAVCFALAKGLAAAGH--EVTLVSPFPQRKPIKNIIDVETPNIITVMGVYKARILENAKKPVL- 96
            |.....||||.|.|:.:  .|||:                         |..:|:.::|...|. 
plant    15 HIRATTALAKLLVASDNRLSVTLI-------------------------VIPSRVSDDASSSVYT 54

  Fly    97 -----LRYPRISLMGLDITESLL-----KEPKVQELLKQNRTFDGVICETFMNDAHYGFAEHFGA 151
                 |||  |.|...|.|..|:     ::|:|:.::.:                       ...
plant    55 NSEDRLRY--ILLPARDQTTDLVSYIDSQKPQVRAVVSK-----------------------VAG 94

  Fly   152 PLITLSSLGATGWTSDLVGTPSPPSYVPHSLLRFGDRMN------FWERAQNLGFQIY------- 203
            .:.|.|.....|...|:..|         |::...|..|      :...|..||.|.:       
plant    95 DVSTRSDSRLAGIVVDMFCT---------SMIDIADEFNLSAYIFYTSNASYLGLQFHVQSLYDE 150

  Fly   204 ------EFA-YENLINLPR-----------HEALYRKYFPNNKQDFY-----RMRKDTSLVLLNN 245
                  ||. .|...::|.           ...|.:|:||      |     |..:.|..:|:| 
plant   151 KELDVSEFKDTEMKFDVPTLTQPFPAKCLPSVMLNKKWFP------YVLGRARSFRATKGILVN- 208

  Fly   246 HVSISNPRPYSPNMIEVGGMHVNRK---APKPL-------PQNIRKFI-----EEAEHGVIYFSL 295
              |:::..|.:.:....|..:.|..   |..|:       .:..||.|     |:....|::...
plant   209 --SVADMEPQALSFFSGGNGNTNIPPVYAVGPIMDLESSGDEEKRKEILHWLKEQPTKSVVFLCF 271

  Fly   296 GSNLNSKDLPENKRKAIVETLRGLKYRVIWKYEEET-----------------------FVDKPD 337
            ||   .....|.:.:.|...|....:|.:|.....:                       |:|:..
plant   272 GS---MGGFSEEQAREIAVALERSGHRFLWSLRRASPVGNKSNPPPGEFTNLEEILPKGFLDRTV 333

  Fly   338 NV-LISNWLPQDDILAHEKVIAFITHGGLLSTMESIYHGKPVVGIPFFGDQFMN-MARAEQMGYG 400
            .: .|.:|.||.|:|....:.||:||.|..|.:||::.|.|:...|.:.:|..| ....:::|..
plant   334 EIGKIISWAPQVDVLNSPAIGAFVTHCGWNSILESLWFGVPMAAWPIYAEQQFNAFHMVDELGLA 398

  Fly   401 ITVK 404
            ..||
plant   399 AEVK 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302E1NP_652625.2 egt <114..464 CDD:223071 69/372 (19%)
UGT71B1NP_188812.1 Glycosyltransferase_GTB_type 1..473 CDD:299143 91/459 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.