DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302E1 and UGT74F2

DIOPT Version :9

Sequence 1:NP_652625.2 Gene:Ugt302E1 / 53508 FlyBaseID:FBgn0040257 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_181910.1 Gene:UGT74F2 / 818986 AraportID:AT2G43820 Length:449 Species:Arabidopsis thaliana


Alignment Length:484 Identity:101/484 - (20%)
Similarity:170/484 - (35%) Gaps:155/484 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LAKGLAAAGHEVTLVSPFPQ------RKPIKNII------------DVETP-NIITVMGVYKARI 87
            ||......||    ::||.|      .|.:|..:            |:..| :|.|:...|....
plant     9 LAVPYPTQGH----ITPFRQFCKRLHFKGLKTTLALTTFVFNSINPDLSGPISIATISDGYDHGG 69

  Fly    88 LENAKKPVLLRYPRISLMGLDITESLLKEPK------VQELLKQNRTFDG----VICETFMNDAH 142
            .|.|                |..:..||:.|      :.:::::::|.|.    ::.:.|:..| 
plant    70 FETA----------------DSIDDYLKDFKTSGSKTIADIIQKHQTSDNPITCIVYDAFLPWA- 117

  Fly   143 YGFAEHFGAPLITLSSLGATGWTSDLVGTP--SPP---SYVPH-SLLRFGDRMNFWERAQNLGFQ 201
            ...|..||                 ||.||  :.|   :||.: |.:..|          :|...
plant   118 LDVAREFG-----------------LVATPFFTQPCAVNYVYYLSYINNG----------SLQLP 155

  Fly   202 IYEFAYENLINLPRHEAL---YRKYFPNNKQDFYRMRKDTSLVLLNNHVSISNPRPYSPNMIEVG 263
            |.|..:..|.:||...::   |..||....|.|....| ...||:|:...:.             
plant   156 IEELPFLELQDLPSFFSVSGSYPAYFEMVLQQFINFEK-ADFVLVNSFQELE------------- 206

  Fly   264 GMHVNRKAPKPLP--------------QNIR-------------------KFIEEAEHG-VIYFS 294
             :|.|....|..|              |.|:                   .:::....| |:|.:
plant   207 -LHENELWSKACPVLTIGPTIPSIYLDQRIKSDTGYDLNLFESKDDSFCINWLDTRPQGSVVYVA 270

  Fly   295 LGSNLNSKDLPENKRKAIVETLRGLKYRVIW---KYEEETF-------VDKPDNVLISNWLPQDD 349
            .||.....::...:..:.|.     .:..:|   ..|||..       |:| :..|:..|.||..
plant   271 FGSMAQLTNVQMEELASAVS-----NFSFLWVVRSSEEEKLPSGFLETVNK-EKSLVLKWSPQLQ 329

  Fly   350 ILAHEKVIAFITHGGLLSTMESIYHGKPVVGIPFFGDQFMNMARAEQM-GYGITVKYAQLTASLF 413
            :|:::.:..|:||.|..||||::..|.|:|.:|.:.||.||....:.: ..|:.||..:.:....
plant   330 VLSNKAIGCFLTHCGWNSTMEALTFGVPMVAMPQWTDQPMNAKYIQDVWKAGVRVKTEKESGIAK 394

  Fly   414 RSAIERITSDPSFTERVKVIS---SQYRD 439
            |..||....:....||.|.:.   .::||
plant   395 REEIEFSIKEVMEGERSKEMKKNVKKWRD 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302E1NP_652625.2 egt <114..464 CDD:223071 84/393 (21%)
UGT74F2NP_181910.1 PLN02173 1..449 CDD:177830 101/484 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.