DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302E1 and AT2G36970

DIOPT Version :9

Sequence 1:NP_652625.2 Gene:Ugt302E1 / 53508 FlyBaseID:FBgn0040257 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_181234.1 Gene:AT2G36970 / 818271 AraportID:AT2G36970 Length:490 Species:Arabidopsis thaliana


Alignment Length:198 Identity:50/198 - (25%)
Similarity:79/198 - (39%) Gaps:48/198 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 VIYFSLGSNLNSKDLPENKRKAIVETLRGL---KYRVIWKYEEET------------FVDK-PDN 338
            |:|.|.||..:.      .:|.|||...||   ....||....:.            |||: .|.
plant   287 VLYVSFGSYAHV------GKKEIVEIAHGLLLSGISFIWVLRPDIVGSNVPDFLPAGFVDQAQDR 345

  Fly   339 VLISNWLPQDDILAHEKVIAFITHGGLLSTMESIYHGKPVVGIPFFGDQFMNMAR-AEQMGYGI- 401
            .|:..|..|.:::::..|..|.||.|..|.:||::.|.|::..|...|||.|... .:....|| 
plant   346 GLVVQWCCQMEVISNPAVGGFFTHCGWNSILESVWCGLPLLCYPLLTDQFTNRKLVVDDWCIGIN 410

  Fly   402 -----TVKYAQL-----------TASLFRSAIER--------ITSDPSFTERVKVISSQYRDQKE 442
                 |:...|:           |:|..|:.:|:        :|:..|......:..|:.|::.|
plant   411 LCEKKTITRDQVSANVKRLMNGETSSELRNNVEKVKRHLKDAVTTVGSSETNFNLFVSEVRNRIE 475

  Fly   443 TPL 445
            |.|
plant   476 TKL 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302E1NP_652625.2 egt <114..464 CDD:223071 50/198 (25%)
AT2G36970NP_181234.1 Glycosyltransferase_GTB_type 1..470 CDD:299143 46/188 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.