DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302E1 and UGT73C6

DIOPT Version :9

Sequence 1:NP_652625.2 Gene:Ugt302E1 / 53508 FlyBaseID:FBgn0040257 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_181217.1 Gene:UGT73C6 / 818251 AraportID:AT2G36790 Length:495 Species:Arabidopsis thaliana


Alignment Length:428 Identity:100/428 - (23%)
Similarity:172/428 - (40%) Gaps:85/428 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SKSHYAVCFALAKGLAAAGHEVTLVSPFPQRKPIKNIID--VETP---NIITVMGVYKARILENA 91
            ::.|......:|:.||..|..:|:|:........||:::  :|:.   |::.|...|:...|:..
plant    21 AQGHMIPMVDIARLLAQRGVLITIVTTPHNAARFKNVLNRAIESGLPINLVQVKFPYQEAGLQEG 85

  Fly    92 KKPVLLRYPRISLMGLDITESLLKEPKVQELLKQNRTFDGVI----CETFMNDAHYGFAEHFGAP 152
            ::.:.|......:.......:||||| ||.|:::.......:    |.::.::    .|:.|..|
plant    86 QENMDLLTTMEQITSFFKAVNLLKEP-VQNLIEEMSPRPSCLISDMCLSYTSE----IAKKFKIP 145

  Fly   153 LITLSSLGA---------TGWTSDLVGTPSPPSY--VPHSLLRFGDRMNF--------------W 192
            .|....:|.         ......|....|...|  ||:    |.||:.|              |
plant   146 KILFHGMGCFCLLCVNVLRKNREILDNLKSDKEYFIVPY----FPDRVEFTRPQVPVETYVPAGW 206

  Fly   193 ERAQNLGFQIYEFAYENLINLPRHEALYRKYFPNNKQDFYRMRKDTSLVLLNNHVSISNPRPYSP 257
            :.......:..:.:|..::|      .:::..|...:||...|...:..:  ..||:.|      
plant   207 KEILEDMVEADKTSYGVIVN------SFQELEPAYAKDFKEARSGKAWTI--GPVSLCN------ 257

  Fly   258 NMIEVGGMHVNRKAPKPLPQN-IRKFIEEAEHG-VIYFSLGSNLNSKDLP-----------ENKR 309
               :||.....|.....:.|: ..::::..|.| |:|..|||..|   ||           |..:
plant   258 ---KVGVDKAERGNKSDIDQDECLEWLDSKEPGSVLYVCLGSICN---LPLSQLLELGLGLEESQ 316

  Fly   310 KAIVETLRGL-KYR--VIWKYEEETFVDKPDN--VLISNWLPQDDILAHEKVIAFITHGGLLSTM 369
            :..:..:||. ||:  |.| :.|..|.|:..:  :||..|.||..||:|..|..|:||.|..||:
plant   317 RPFIWVIRGWEKYKELVEW-FSESGFEDRIQDRGLLIKGWSPQMLILSHPSVGGFLTHCGWNSTL 380

  Fly   370 ESIYHGKPVVGIPFFGDQFMN---MARAEQMGYGITVK 404
            |.|..|.|::..|.|.|||.|   :.:..::|....||
plant   381 EGITAGLPMLTWPLFADQFCNEKLVVQILKVGVSAEVK 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302E1NP_652625.2 egt <114..464 CDD:223071 84/341 (25%)
UGT73C6NP_181217.1 Glycosyltransferase_GTB-type 12..494 CDD:385653 100/428 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.