DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302E1 and UGT71C2

DIOPT Version :9

Sequence 1:NP_652625.2 Gene:Ugt302E1 / 53508 FlyBaseID:FBgn0040257 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_180535.1 Gene:UGT71C2 / 817524 AraportID:AT2G29740 Length:474 Species:Arabidopsis thaliana


Alignment Length:487 Identity:107/487 - (21%)
Similarity:173/487 - (35%) Gaps:171/487 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 HYAVCFALAKGLAAAG----HEVTLVS---PF-PQRKPI---KNIIDVETP-NIITVMGVY---- 83
            |......|||.|.:..    |.:|::.   || ||...|   |::|:.|:. .:||:..|.    
plant    19 HILATIELAKRLISHQPSRIHTITILHWSLPFLPQSDTIAFLKSLIETESRIRLITLPDVQNPPP 83

  Fly    84 --------KARILENAKKPV-LLRYPRISLMG--------------------------------- 106
                    ::.|||..||.| |:|....:|:.                                 
plant    84 MELFVKASESYILEYVKKMVPLVRNALSTLLSSRDESDSVHVAGLVLDFFCVPLIDVGNEFNLPS 148

  Fly   107 ---LDITESLLKEPKVQELLKQNRTFDGVICETFMNDAHYGFAEHFGAPLITLSSLGATGWTSDL 168
               |..:.|.|...|.  ||::||       ||              .|.:..||      ..:.
plant   149 YIFLTCSASFLGMMKY--LLERNR-------ET--------------KPELNRSS------DEET 184

  Fly   169 VGTPSPPSYVPHSLLRFG----DRMNFW-ERAQNLGFQIYEFAYENLINLPRHEALYRKYFPNNK 228
            :..|...:.||..:|..|    :....| |.|:.     :..|...|:|  ..|:|.|..|    
plant   185 ISVPGFVNSVPVKVLPPGLFTTESYEAWVEMAER-----FPEAKGILVN--SFESLERNAF---- 238

  Fly   229 QDFYRMRKDTSLVLLNNH--------VSISNPRPYSPNMIEVGGMHVNRKAPKPLPQNIRKFI-E 284
             |::..|.|       |:        :..||.||         .:.::.:      ..|.|:: :
plant   239 -DYFDRRPD-------NYPPVYPIGPILCSNDRP---------NLDLSER------DRILKWLDD 280

  Fly   285 EAEHGVIYFSLGSNLNSKDLPENKRKAIVETLRGLKYRVIW-------KYEEETFVDKPDNV--- 339
            :.|..|::...||   .|.|..::.|.|.:.|..:..|.:|       :|.....: .||..   
plant   281 QPESSVVFLCFGS---LKSLAASQIKEIAQALELVGIRFLWSIRTDPKEYASPNEI-LPDGFMNR 341

  Fly   340 -----LISNWLPQDDILAHEKVIAFITHGGLLSTMESIYHGKPVVGIPFFGDQFMN-MARAEQMG 398
                 |:..|.||.:||||:.:..|::|.|..|.:||:..|.|:...|.:.:|.:| ....:::|
plant   342 VMGLGLVCGWAPQVEILAHKAIGGFVSHCGWNSILESLRFGVPIATWPMYAEQQLNAFTIVKELG 406

  Fly   399 ------------YGITVKYAQLTASLFRSAIE 418
                        ||..|| |...|...||.::
plant   407 LALEMRLDYVSEYGEIVK-ADEIAGAVRSLMD 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302E1NP_652625.2 egt <114..464 CDD:223071 78/347 (22%)
UGT71C2NP_180535.1 PLN02167 4..474 CDD:215112 107/487 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.