DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302E1 and AT2G18570

DIOPT Version :9

Sequence 1:NP_652625.2 Gene:Ugt302E1 / 53508 FlyBaseID:FBgn0040257 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_849978.2 Gene:AT2G18570 / 816372 AraportID:AT2G18570 Length:470 Species:Arabidopsis thaliana


Alignment Length:200 Identity:47/200 - (23%)
Similarity:87/200 - (43%) Gaps:52/200 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 HVNRKAPKPLPQNIRKFI-EEAEHGVIYFSLGS--NLNSKDLPENKRKAIVETLRGLK---YRVI 324
            ||::      |.:|.::: |:.|..|::..|||  .|..:.        .||...||:   .|.:
plant   250 HVDK------PNSIFEWLDEQRERSVVFVCLGSGGTLTFEQ--------TVELALGLELSGQRFV 300

  Fly   325 WKYEE--------------------ETFVDKPDNV--LISNWLPQDDILAHEKVIAFITHGGLLS 367
            |....                    |.|:|:...|  :::.|.||.:||:|..:..|::|.|..|
plant   301 WVLRRPASYLGAISSDDEQVSASLPEGFLDRTRGVGIVVTQWAPQVEILSHRSIGGFLSHCGWSS 365

  Fly   368 TMESIYHGKPVVGIPFFGDQFMNMA-RAEQMGYGITVKYAQLTASLFRSAIERITSDPSFTERVK 431
            .:||:..|.|::..|.:.:|:||.. ..|::  |:.|:.::|.:       ||:.........|:
plant   366 ALESLTKGVPIIAWPLYAEQWMNATLLTEEI--GVAVRTSELPS-------ERVIGREEVASLVR 421

  Fly   432 VISSQ 436
            .|.::
plant   422 KIMAE 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302E1NP_652625.2 egt <114..464 CDD:223071 47/199 (24%)
AT2G18570NP_849978.2 PLN03015 1..470 CDD:178589 47/199 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.