DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302E1 and UGT73B5

DIOPT Version :9

Sequence 1:NP_652625.2 Gene:Ugt302E1 / 53508 FlyBaseID:FBgn0040257 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001189528.1 Gene:UGT73B5 / 816040 AraportID:AT2G15480 Length:494 Species:Arabidopsis thaliana


Alignment Length:274 Identity:59/274 - (21%)
Similarity:105/274 - (38%) Gaps:51/274 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 DFYRMRKDTSLVLLNNHVSISNPRPYSPNMIEVGGMHVNRKAPKPLPQNI-----RKFIEEAEHG 289
            ||||              |....|.:....:.:....:..||.:....||     .|:::....|
plant   238 DFYR--------------SFVAKRAWHIGPLSLSNRELGEKARRGKKANIDEQECLKWLDSKTPG 288

  Fly   290 -VIYFSLGSNLNSKDLPENKRKAIVETLRGLKYRVIW------------KYEEETFVDKP--DNV 339
             |:|.|.||..|   ...::...|...|.|.....||            ::..|.|.::.  ..:
plant   289 SVVYLSFGSGTN---FTNDQLLEIAFGLEGSGQSFIWVVRKNENQGDNEEWLPEGFKERTTGKGL 350

  Fly   340 LISNWLPQDDILAHEKVIAFITHGGLLSTMESIYHGKPVVGIPFFGDQFMN---MARAEQMGYGI 401
            :|..|.||..||.|:.:..|:||.|..|.:|.|..|.|:|..|...:||.|   :.:..::|..:
plant   351 IIPGWAPQVLILDHKAIGGFVTHCGWNSAIEGIAAGLPMVTWPMGAEQFYNEKLLTKVLRIGVNV 415

  Fly   402 ----TVKYAQLTASLFRSAIERITSDPSFTERV--KVISSQYRDQKETPLERAVYWVEHVTRHKG 460
                .||..:|   :.|:.:|:...:....|:.  :||..:..:::....:......:......|
plant   416 GATELVKKGKL---ISRAQVEKAVREVIGGEKAVREVIGGEKAEERRLRAKELGEMAKAAVEEGG 477

  Fly   461 AKY--LRSACQDLN 472
            :.|  :....::||
plant   478 SSYNDVNKFMEELN 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302E1NP_652625.2 egt <114..464 CDD:223071 57/264 (22%)
UGT73B5NP_001189528.1 PLN03007 4..494 CDD:178584 59/274 (22%)
MGT 14..456 CDD:273616 55/237 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.