DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302E1 and UGT3A2

DIOPT Version :9

Sequence 1:NP_652625.2 Gene:Ugt302E1 / 53508 FlyBaseID:FBgn0040257 Length:521 Species:Drosophila melanogaster
Sequence 2:XP_011512290.1 Gene:UGT3A2 / 167127 HGNCID:27266 Length:550 Species:Homo sapiens


Alignment Length:527 Identity:153/527 - (29%)
Similarity:231/527 - (43%) Gaps:80/527 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QSWGYSYLMISH------------TASKSHYAVCFALAK----GLAAAGHE------VTLVSPFP 60
            |..|::..|::|            .||.|.|.....|.|    ||.....|      ::.::|..
Human    47 QDHGHNVTMLNHKRGPFMPGLSDSPASASRYPRILYLQKYCQFGLKDFKKEEKSYQVISWLAPED 111

  Fly    61 QRKPIKNIIDVETPNIITVMGVYKARILENAKKPVLLRYPRISLMGLDITESLLKEPKVQELLKQ 125
            .::..|...|.....  |:.|..|...|.|..:.:.|:.... |...||.:||           :
Human   112 HQREFKKSFDFFLEE--TLGGRGKFENLLNVLEYLALQCSHF-LNRKDIMDSL-----------K 162

  Fly   126 NRTFDGVICETFMNDAHYGFAEHFGAPLITLSSLGATGWTSDLVGTPSPPSYVP--HSLLRFGDR 188
            |..||.||.||| :...:..||..|.|.:.:.|   |.:.|...|.|.|.||||  .|||.  |.
Human   163 NENFDMVIVETF-DYCPFLIAEKLGKPFVAILS---TSFGSLEFGLPIPLSYVPVFRSLLT--DH 221

  Fly   189 MNFWERAQNLGFQIYEFAYENLINLPRHEALYRKYFPNNKQDFY---------RMRKDTSLVLLN 244
            |:||.|.:|. ...:.|.        |.:...:..|.|..::.:         .:.....|..:|
Human   222 MDFWGRVKNF-LMFFSFC--------RRQQHMQSTFDNTIKEHFTEGSRPVLSHLLLKAELWFIN 277

  Fly   245 NHVSISNPRPYSPNMIEVGGMHVNRKAPKPLPQNIRKFIEE-AEHGVIYFSLGSNLNSKDLPE-- 306
            :..:....||..||.:.|||:  ..|..||:||::..||.: .:.|.:..:|||.:|:...||  
Human   278 SDFAFDFARPLLPNTVYVGGL--MEKPIKPVPQDLENFIAKFGDSGFVLVTLGSMVNTCQNPEIF 340

  Fly   307 -NKRKAIVETLRGLKYRVIWKYEEETF---VDKPDNVLISNWLPQDDILAHEKVIAFITHGGLLS 367
             ....|.....:|    ||||.:...:   |....||.|.:||||.|:|||..:..|:||||..|
Human   341 KEMNNAFAHLPQG----VIWKCQCSHWPKDVHLAANVKIVDWLPQSDLLAHPSIRLFVTHGGQNS 401

  Fly   368 TMESIYHGKPVVGIPFFGDQFMNMARAEQMGYGITVKYAQLTASLFRSAIERITSDPSFTERVKV 432
            .||:|.||.|:||||.||||..||.|.|...:|::::..:|.|......:::|..|..:......
Human   402 IMEAIQHGVPMVGIPLFGDQPENMVRVEAKKFGVSIQLKKLKAETLALKMKQIMEDKRYKSAAVA 466

  Fly   433 ISSQYRDQKETPLERAVYWVEHVTRHKGAKYLRSACQDLNFIQ-YHNLDVLATFFSVIGLTVIFV 496
            .|...|....:|.:|.|.|::||.:..||.:|:...    |.| :|...:|..|..::|||:..:
Human   467 ASVILRSHPLSPTQRLVGWIDHVLQTGGATHLKPYV----FQQPWHEQYLLDVFVFLLGLTLGTL 527

  Fly   497 FLLVRFL 503
            :|..:.|
Human   528 WLCGKLL 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302E1NP_652625.2 egt <114..464 CDD:223071 115/367 (31%)
UGT3A2XP_011512290.1 UDPGT 23..518 CDD:278624 148/509 (29%)
egt <162..517 CDD:223071 120/379 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150558
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3869
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.770

Return to query results.
Submit another query.