DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35C1 and UGT73B4

DIOPT Version :10

Sequence 1:NP_001097744.1 Gene:Ugt35C1 / 53507 FlyBaseID:FBgn0040256 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_179151.2 Gene:UGT73B4 / 816041 AraportID:AT2G15490 Length:484 Species:Arabidopsis thaliana


Alignment Length:118 Identity:31/118 - (26%)
Similarity:48/118 - (40%) Gaps:33/118 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   328 KILEYQLCHRLE---NADHFLPEDCNSVRVKKSDNNGDDKWTHTIDLSTFLEHGNKYHVQ----- 384
            |.:|.:...||.   .|:|         ::|:|.:...|..:|...||   |.|:|..:|     
plant   835 KDIERENSERLREPPQAEH---------KIKESRSPVKDPPSHDKRLS---EDGSKPVIQSVSPY 887

  Fly   385 --------LKARNALGWGSMAKDALHVELQRIE-----KEEAKGASIISIISS 424
                    ||..|.:|..|..|..|..:.|:|:     |||.|..|.:.::.|
plant   888 GKPALSDSLKLSNLVGKESEKKLELPSDFQKIKSDVKVKEERKEDSDVLVVGS 940

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35C1NP_001097744.1 Glycosyltransferase_GTB-type 45..477 CDD:471961 31/118 (26%)
UGT73B4NP_179151.2 PLN03007 1..484 CDD:178584
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.