DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35E2 and UGT85A4

DIOPT Version :9

Sequence 1:NP_652623.2 Gene:Ugt35E2 / 53506 FlyBaseID:FBgn0040255 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_177950.1 Gene:UGT85A4 / 844162 AraportID:AT1G78270 Length:489 Species:Arabidopsis thaliana


Alignment Length:262 Identity:60/262 - (22%)
Similarity:104/262 - (39%) Gaps:72/262 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 ERHEAVYRKYFPKIADKRSLSEITRNFALILVNQHFTMAPPRPYVPNIIEVGGMHV--------- 272
            :|..|::...|.|:                   :|..:...|..:|.|..||...:         
plant   224 KRASAIFINTFEKL-------------------EHNVLLSLRSLLPQIYSVGPFQILENREIDKN 269

  Fly   273 -----------DQQPKALPQDLEDFIQGAGEHGVIYFSLG--TNVRSRNLSKDRRKILIDTFASL 324
                       :::.::|     |::....|..|||.:.|  |.:.|..:.:     .....|..
plant   270 SEIRKLGLNLWEEETESL-----DWLDTKAEKAVIYVNFGSLTVLTSEQILE-----FAWGLARS 324

  Fly   325 PQRILW-----KFDADE-------LSDVPS-NVLISPWFPQQDILAHPNVKLFITHGGLQSTVEC 376
            .:..||     ..|.|:       ||:..: .:||..|..|:.:|:||.:..|:||.|..||:|.
plant   325 GKEFLWVVRSGMVDGDDSILPAEFLSETKNRGMLIKGWCSQEKVLSHPAIGGFLTHCGWNSTLES 389

  Fly   377 IHRGVPMLGLPFFYDQFRNMEH-IKAQGIGLVLNYRDMTSDEFK-DTIHQLLTEKSFGVKAKRTA 439
            ::.||||:..|||.||..|.:. .:..|||:.:      .:|.| :.:..::.|...|.|.||..
plant   390 LYAGVPMICWPFFADQLTNRKFCCEDWGIGMEI------GEEVKRERVETVVKELMDGEKGKRLR 448

  Fly   440 DR 441
            ::
plant   449 EK 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35E2NP_652623.2 egt 23..481 CDD:223071 60/262 (23%)
YjiC 26..440 CDD:224732 60/259 (23%)
UGT85A4NP_177950.1 Glycosyltransferase_GTB-type 5..480 CDD:415824 60/262 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.