DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35E2 and UGT76C1

DIOPT Version :9

Sequence 1:NP_652623.2 Gene:Ugt35E2 / 53506 FlyBaseID:FBgn0040255 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_196206.1 Gene:UGT76C1 / 830472 AraportID:AT5G05870 Length:464 Species:Arabidopsis thaliana


Alignment Length:280 Identity:73/280 - (26%)
Similarity:109/280 - (38%) Gaps:67/280 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 KIADKRSLSEITRNFALILVNQHFTMAPPRPYVPNIIEVGGMHVDQQPKALPQDLE------DFI 287
            |..|..||:|..:.|::             |..|    :|..|:...|.:....||      .::
plant   217 KELDHDSLAESNKVFSI-------------PIFP----IGPFHIHDVPASSSSLLEPDQSCIPWL 264

  Fly   288 QGAGEHGVIYFSLGTNVRSRNLSKDRRKILIDTFASLPQRILW------KFDADELSDVPSNVL- 345
            .......|:|.||| ::.|.|.| |..:|... ..:..|..||      ....|.:..:||..: 
plant   265 DMRETRSVVYVSLG-SIASLNES-DFLEIACG-LRNTNQSFLWVVRPGSVHGRDWIESLPSGFME 326

  Fly   346 -------ISPWFPQQDILAHPNVKLFITHGGLQSTVECIHRGVPMLGLPFFYDQFRNMEHI-KAQ 402
                   |..|.||.|:|||.....|:||.|..||:|.|..||||:.||..:|||.|...| :..
plant   327 SLDGKGKIVRWAPQLDVLAHRATGGFLTHNGWNSTLESICEGVPMICLPCKWDQFVNARFISEVW 391

  Fly   403 GIGLVLNYRDMTSDEFKDTIHQLLTEKSFGVKAKRTADRYRDQPMNPLDTAIWWTHYVLRHKGAP 467
            .:|:.|..| :...|.:..:.:|:.|.    |.:....|.:                |||.:...
plant   392 RVGIHLEGR-IERREIERAVIRLMVES----KGEEIRGRIK----------------VLRDEVRR 435

  Fly   468 HMRVAGRNLDFITYHSLDVL 487
            .::..|.     :|.|||.|
plant   436 SVKQGGS-----SYRSLDEL 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35E2NP_652623.2 egt 23..481 CDD:223071 68/272 (25%)
YjiC 26..440 CDD:224732 63/231 (27%)
UGT76C1NP_196206.1 Glycosyltransferase_GTB_type 2..451 CDD:299143 73/280 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.