DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35E2 and AT4G36770

DIOPT Version :9

Sequence 1:NP_652623.2 Gene:Ugt35E2 / 53506 FlyBaseID:FBgn0040255 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_195395.4 Gene:AT4G36770 / 829830 AraportID:AT4G36770 Length:457 Species:Arabidopsis thaliana


Alignment Length:284 Identity:65/284 - (22%)
Similarity:102/284 - (35%) Gaps:89/284 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 RKYFPKIADKR------------------SLSEITRNFALILVNQHFTM--APPRPYVPNI--IE 266
            |||..::|:.:                  ||.::|....|...|....|  .|..|..|.:  .|
plant   182 RKYIRELAESQRIGDEVITADGVFVNTWHSLEQVTIGSFLDPENLGRVMRGVPVYPVGPLVRPAE 246

  Fly   267 VGGMH-----VDQQPKALPQDLEDFIQGAGEHGVIYFSLG---------TNVRSRNLSK------ 311
            .|..|     :|.|||               ..|:|.|.|         ||..:..|..      
plant   247 PGLKHGVLDWLDLQPK---------------ESVVYVSFGSGGALTFEQTNELAYGLELTGHRFV 296

  Fly   312 ----------------DRRKILIDTFASLPQRILWKFDADELSDVPSNVLISPWFPQQDILAHPN 360
                            |:.|...:....||...|     |...|:  .:::..|.||::||||.:
plant   297 WVVRPPAEDDPSASMFDKTKNETEPLDFLPNGFL-----DRTKDI--GLVVRTWAPQEEILAHKS 354

  Fly   361 VKLFITHGGLQSTVECIHRGVPMLGLPFFYDQFRNMEHIKAQ-GIGLVLNYRD--MTSDEFKDTI 422
            ...|:||.|..|.:|.|..||||:..|.:.:|..|...:..: .|.|.:|..|  :..:...:.:
plant   355 TGGFVTHCGWNSVLESIVNGVPMVAWPLYSEQKMNARMVSGELKIALQINVADGIVKKEVIAEMV 419

  Fly   423 HQLLTEKS-----FGVK-AKRTAD 440
            .:::.|:.     ..|| .|:||:
plant   420 KRVMDEEEGKEMRKNVKELKKTAE 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35E2NP_652623.2 egt 23..481 CDD:223071 65/284 (23%)
YjiC 26..440 CDD:224732 64/282 (23%)
AT4G36770NP_195395.4 Glycosyltransferase_GTB_type 4..448 CDD:299143 65/284 (23%)
YjiC 6..451 CDD:224732 65/284 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.