DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35E2 and AT4G14090

DIOPT Version :9

Sequence 1:NP_652623.2 Gene:Ugt35E2 / 53506 FlyBaseID:FBgn0040255 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_193146.1 Gene:AT4G14090 / 827046 AraportID:AT4G14090 Length:456 Species:Arabidopsis thaliana


Alignment Length:349 Identity:80/349 - (22%)
Similarity:137/349 - (39%) Gaps:57/349 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 GVRREILQP----ESLQFDLIIVDLW-----RLDALYGLAAYFDAPIIGIASYGTDWKIDELVGN 174
            ||...:|.|    .:.:|.|....||     .||..|    |:         :.|.:|   .:.:
plant   116 GVIYSVLVPWVSTVAREFHLPTTLLWIEPATVLDIYY----YY---------FNTSYK---HLFD 164

  Fly   175 VSPLAYLQSPSFNWFDLDTYGGRLGHFVDQSMAWINWHWRHEERHEAVYRKYFPKIADKRSLSEI 239
            |.|:...:.|.....||.:       |:..|.|..:......|..||:..:..|||. ..:.|.:
plant   165 VEPIKLPKLPLITTGDLPS-------FLQPSKALPSALVTLREHIEALETESNPKIL-VNTFSAL 221

  Fly   240 TRNFALILVNQHFTMAPPRPYVPNIIEVGGMHVDQQPKALPQDLEDFIQGAGEHGVIYFSLGTNV 304
            ..: ||..| :...|.|..|.|.:......:.     |:..:|...::....|..|||.||||: 
plant   222 EHD-ALTSV-EKLKMIPIGPLVSSSEGKTDLF-----KSSDEDYTKWLDSKLERSVIYISLGTH- 278

  Fly   305 RSRNLSKDRRKILIDTFASLPQRILW-----------KFDADELSDVPSNVLISPWFPQQDILAH 358
             :.:|.:...:.|.....:..:..||           |....||.......|:..|..|..:|||
plant   279 -ADDLPEKHMEALTHGVLATNRPFLWIVREKNPEEKKKNRFLELIRGSDRGLVVGWCSQTAVLAH 342

  Fly   359 PNVKLFITHGGLQSTVECIHRGVPMLGLPFFYDQFRNMEHIK-AQGIGL---VLNYRDMTSDEFK 419
            ..|..|:||.|..||:|.:..|||::..|.|.||....:.:: ...||:   |....|:..:|.:
plant   343 CAVGCFVTHCGWNSTLESLESGVPVVAFPQFADQCTTAKLVEDTWRIGVKVKVGEEGDVDGEEIR 407

  Fly   420 DTIHQLLTEKSFGVKAKRTADRYR 443
            ..:.::::......:.:..|::::
plant   408 RCLEKVMSGGEEAEEMRENAEKWK 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35E2NP_652623.2 egt 23..481 CDD:223071 80/349 (23%)
YjiC 26..440 CDD:224732 79/344 (23%)
AT4G14090NP_193146.1 YjiC 11..445 CDD:224732 80/349 (23%)
Glycosyltransferase_GTB_type 12..454 CDD:299143 80/349 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.