DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35E2 and AT3G22250

DIOPT Version :9

Sequence 1:NP_652623.2 Gene:Ugt35E2 / 53506 FlyBaseID:FBgn0040255 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_188864.1 Gene:AT3G22250 / 821795 AraportID:AT3G22250 Length:461 Species:Arabidopsis thaliana


Alignment Length:403 Identity:80/403 - (19%)
Similarity:145/403 - (35%) Gaps:115/403 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 VEKVLEN---DGVRREILQPESLQFDLIIVDL---WRLDALYGLAAYFDAPIIG-----IASYGT 164
            :|..:||   ..:.|.:|: |.|....::|||   |.:    |:|.....|:.|     .|:|..
plant    80 IENSMENIMPPQLERLLLE-EDLDVACVVVDLLASWAI----GVADRCGVPVAGFWPVMFAAYRL 139

  Fly   165 DWKIDELV--GNVS-----------------PLAYLQSPSFNWFDLDTYGGRLGHFV-------- 202
            ...|.|||  |.||                 ||  |.:....|. :.|...:...|.        
plant   140 IQAIPELVRTGLVSQKGCPRQLEKTIVQPEQPL--LSAEDLPWL-IGTPKAQKKRFKFWQRTLER 201

  Fly   203 DQSMAWI-----NWHWRHEERHEAVYRKYFPKIADKRSLSEITRNFALILVNQHFTMAPPRPYVP 262
            .:|:.||     ...:...:.|:|.|:|     ::..:.....:|                   |
plant   202 TKSLRWILTSSFKDEYEDVDNHKASYKK-----SNDLNKENNGQN-------------------P 242

  Fly   263 NIIEVGGMHVDQQPKAL--------PQDLE--DFIQGAGEHGVIYFSLGTNVRSRNLSKDRRKIL 317
            .|:.:|.:|..:....:        .:|:.  .::|....:.|||.|.|:.|..  :.:...:.|
plant   243 QILHLGPLHNQEATNNITITKTSFWEEDMSCLGWLQEQNPNSVIYISFGSWVSP--IGESNIQTL 305

  Fly   318 IDTFASLPQRILWKFDADELSDVPSNVL-----------ISPWFPQQDILAHPNVKLFITHGGLQ 371
            .....:..:..||..:......:|...:           |..|.||.::|.:.:|..::||.|..
plant   306 ALALEASGRPFLWALNRVWQEGLPPGFVHRVTITKNQGRIVSWAPQLEVLRNDSVGCYVTHCGWN 370

  Fly   372 STVECIHRGVPMLGLPFFYDQFRNMEHI--------KAQGIGLVLNYRDMTSDEFKDTIHQLLTE 428
            ||:|.:.....:|..|...|||.|.::|        :..|.|         ..|.:|.:.:::.:
plant   371 STMEAVASSRRLLCYPVAGDQFVNCKYIVDVWKIGVRLSGFG---------EKEVEDGLRKVMED 426

  Fly   429 KSFGVKAKRTADR 441
            :..|.:.::..||
plant   427 QDMGERLRKLRDR 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35E2NP_652623.2 egt 23..481 CDD:223071 80/403 (20%)
YjiC 26..440 CDD:224732 78/400 (20%)
AT3G22250NP_188864.1 PLN02562 1..461 CDD:215305 80/403 (20%)
YjiC 6..445 CDD:224732 80/403 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48043
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.150

Return to query results.
Submit another query.