DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35E2 and DOGT1

DIOPT Version :9

Sequence 1:NP_652623.2 Gene:Ugt35E2 / 53506 FlyBaseID:FBgn0040255 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_181218.1 Gene:DOGT1 / 818252 AraportID:AT2G36800 Length:495 Species:Arabidopsis thaliana


Alignment Length:215 Identity:53/215 - (24%)
Similarity:89/215 - (41%) Gaps:52/215 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 EHG-VIYFSLGT---------NVRSRNLSKDRRKIL--IDTFASLPQRILWKFDA---DELSDVP 341
            :|| |:|..||:         ......|.:.:|..:  |..:....:.:.|..::   |.:.|  
plant   285 KHGSVLYVCLGSICNLPLSQLKELGLGLEESQRPFIWVIRGWEKYKELVEWFSESGFEDRIQD-- 347

  Fly   342 SNVLISPWFPQQDILAHPNVKLFITHGGLQSTVECIHRGVPMLGLPFFYDQFRN----MEHIKA- 401
            ..:||..|.||..||:||:|..|:||.|..||:|.|..|:|:|..|.|.|||.|    :|.:|| 
plant   348 RGLLIKGWSPQMLILSHPSVGGFLTHCGWNSTLEGITAGLPLLTWPLFADQFCNEKLVVEVLKAG 412

  Fly   402 --------------QGIGLVLNYRDMTSDEFKDTIHQLLTEKSFGVKAKRTADRYRDQPMNPLDT 452
                          :.||::::     .:..|..:.:|:.|.....:.:|.|....|.       
plant   413 VRSGVEQPMKWGEEEKIGVLVD-----KEGVKKAVEELMGESDDAKERRRRAKELGDS------- 465

  Fly   453 AIWWTHYVLRHKGAPHMRVA 472
                .|..:...|:.|..::
plant   466 ----AHKAVEEGGSSHSNIS 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35E2NP_652623.2 egt 23..481 CDD:223071 53/215 (25%)
YjiC 26..440 CDD:224732 48/181 (27%)
DOGT1NP_181218.1 Glycosyltransferase_GTB-type 6..491 CDD:415824 53/215 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.