DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35E2 and UGT2B4

DIOPT Version :9

Sequence 1:NP_652623.2 Gene:Ugt35E2 / 53506 FlyBaseID:FBgn0040255 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_066962.2 Gene:UGT2B4 / 7363 HGNCID:12553 Length:528 Species:Homo sapiens


Alignment Length:525 Identity:148/525 - (28%)
Similarity:259/525 - (49%) Gaps:76/525 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SHYYHALPYLKKLASLGHEIT------SVSPFPLKEPVANIHDIPVPELFDNIEEIVGNLTNRKG 95
            ||:.:....|.:|...|||:|      |:|..|...........||.......|:|:..|..|  
Human    34 SHWMNIKTILDELVQRGHEVTVLASSASISFDPNSPSTLKFEVYPVSLTKTEFEDIIKQLVKR-- 96

  Fly    96 TWNE------FEYINQYTLGLVEKVL--ENDGVR---REILQPESL-------QFDLIIVDLWRL 142
             |.|      :.|.:|     |::::  .||.:|   ::|:..:.|       :||:::.     
Human    97 -WAELPKDTFWSYFSQ-----VQEIMWTFNDILRKFCKDIVSNKKLMKKLQESRFDVVLA----- 150

  Fly   143 DALYG----LAAYFDAPIIGIASYGTDWKIDELVGN-VSPLAYLQSPSFNWFDLDTYGGRLGHFV 202
            ||::.    ||.....|.:....:...:.|::..|. :.|.:|:........|..|:..|:    
Human   151 DAVFPFGELLAELLKIPFVYSLRFSPGYAIEKHSGGLLFPPSYVPVVMSELSDQMTFIERV---- 211

  Fly   203 DQSMAWINWHWRHEERHEAVYRKYFPKIADKR--------------SLSEITRNFALILVNQHFT 253
             ::|.::            :|.:::.:|.|.:              :|||......:.|:..::.
Human   212 -KNMIYV------------LYFEFWFQIFDMKKWDQFYSEVLGRPTTLSETMAKADIWLIRNYWD 263

  Fly   254 MAPPRPYVPNIIEVGGMHVDQQPKALPQDLEDFIQGAGEHGVIYFSLGTNVRSRNLSKDRRKILI 318
            ...|.|.:||:..|||:|. :..|.||:::|:|:|.:||:||:.||||:.|  .|.|::|..::.
Human   264 FQFPHPLLPNVEFVGGLHC-KPAKPLPKEMEEFVQSSGENGVVVFSLGSMV--SNTSEERANVIA 325

  Fly   319 DTFASLPQRILWKFDADELSDVPSNVLISPWFPQQDILAHPNVKLFITHGGLQSTVECIHRGVPM 383
            ...|.:||::||:||.::...:..|..:..|.||.|:|.||..:.||||||.....|.|:.|:||
Human   326 SALAKIPQKVLWRFDGNKPDTLGLNTRLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPM 390

  Fly   384 LGLPFFYDQFRNMEHIKAQGIGLVLNYRDMTSDEFKDTIHQLLTEKSFGVKAKRTADRYRDQPMN 448
            :|:|.|.||..|:.|:||:|..:.|::..|:|.:..:.:..::.:..:...|.:.:..:.|||:.
Human   391 VGVPLFADQPDNIAHMKAKGAAVSLDFHTMSSTDLLNALKTVINDPLYKENAMKLSRIHHDQPVK 455

  Fly   449 PLDTAIWWTHYVLRHKGAPHMRVAGRNLDFITYHSLDVLGTFLLAVWAILSIVVLCAIKLLRAIL 513
            |||.|::|..:|:|||||.|:|||..:|.:..||||||.|..|..|..::.|:..|...:.:.:.
Human   456 PLDRAVFWIEFVMRHKGAKHLRVAAHDLTWFQYHSLDVTGFLLACVATVIFIITKCLFCVWKFVR 520

  Fly   514 KSKKG 518
            ..|||
Human   521 TGKKG 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35E2NP_652623.2 egt 23..481 CDD:223071 134/486 (28%)
YjiC 26..440 CDD:224732 115/445 (26%)
UGT2B4NP_066962.2 egt 8..512 CDD:223071 144/510 (28%)
UDPGT 24..524 CDD:278624 145/522 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150428
Domainoid 1 1.000 260 1.000 Domainoid score I1978
eggNOG 1 0.900 - - E33208_3BDT1
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 267 1.000 Inparanoid score I3041
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 1 1.000 - - mtm8543
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.690

Return to query results.
Submit another query.