DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35E1 and UGT78D1

DIOPT Version :9

Sequence 1:NP_652622.3 Gene:Ugt35E1 / 53504 FlyBaseID:FBgn0040253 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_564357.1 Gene:UGT78D1 / 839933 AraportID:AT1G30530 Length:453 Species:Arabidopsis thaliana


Alignment Length:496 Identity:101/496 - (20%)
Similarity:158/496 - (31%) Gaps:207/496 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ILALFPVPSHSHYYHALPYL---KNLASLGHEI---------TSVSPFPSEEPVK-NIYDIY--V 72
            :||.|||.:     ||.|.|   :.||:.....         ::.|.|.|:.|.. .::|:.  |
plant    15 VLAFFPVGA-----HAGPLLAVTRRLAAASPSTIFSFFNTARSNASLFSSDHPENIKVHDVSDGV 74

  Fly    73 PE--VLNSFDELLKQMTTPKNTWEFFDATNEFVYNITKDVFNNDGVRREILRPGKAQFDLIIVDI 135
            ||  :|.:..|:::.         |.:|...        :|.::....|| ..||.      |..
plant    75 PEGTMLGNPLEMVEL---------FLEAAPR--------IFRSEIAAAEI-EVGKK------VTC 115

  Fly   136 WKYDAFYSLAAYFEAPIIGLAPCGIDWKIDEMVGNPSPMSYLQSPSSYLYNLDTFGGRVAHVVEV 200
            ...|||:..||...|.:                 |.:.:::....::.|         .||:   
plant   116 MLTDAFFWFAADIAAEL-----------------NATWVAFWAGGANSL---------CAHL--- 151

  Fly   201 AISWFNWHWRYEQKHEALYKKYFPKIAETKPLSEISQDIALVLVNQHFTLGPPRPYVPNVIEVGG 265
                                 |...|.||..|.::|.:         .|||    ::|.:.....
plant   152 ---------------------YTDLIRETIGLKDVSME---------ETLG----FIPGMENYRV 182

  Fly   266 MHIDEQ----------PKALAQ-----------------DLE--------------------DFI 283
            ..|.|:          ||||.|                 :||                    ..:
plant   183 KDIPEEVVFEDLDSVFPKALYQMSLALPRASAVFISSFEELEPTLNYNLRSKLKRFLNIAPLTLL 247

  Fly   284 QGSGE------HG------------VIYFSLGTNVRTKNMVDDRKRILIEAFGSLPQRV--LWKF 328
            ..:.|      ||            |.|.|.||     .|....:.::..|.|....:|  :|..
plant   248 SSTSEKEMRDPHGCFAWMGKRSAASVAYISFGT-----VMEPPPEELVAIAQGLESSKVPFVWSL 307

  Fly   329 EDEELQDIPSNVLVR--------KWLPQQDLLAHPKVKLFITHGGMQSTIESIHYGKPMLGLPFF 385
            :::.:..:|...|.|        .|.||.:||.|..:.:.:||.|..|.:||:..|.||:|.|..
plant   308 KEKNMVHLPKGFLDRTREQGIVVPWAPQVELLKHEAMGVNVTHCGWNSVLESVSAGVPMIGRPIL 372

  Fly   386 YDQFTN-------------VDH--IKKHGFCLSLN---YHD 408
            .|...|             :|:  ..|.||...||   .||
plant   373 ADNRLNGRAVEVVWKVGVMMDNGVFTKEGFEKCLNDVFVHD 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35E1NP_652622.3 egt 6..461 CDD:223071 101/496 (20%)
UDPGT 33..484 CDD:278624 96/486 (20%)
UGT78D1NP_564357.1 GT1_Gtf-like 12..432 CDD:340817 101/496 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.