DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35E1 and UGT85A5

DIOPT Version :9

Sequence 1:NP_652622.3 Gene:Ugt35E1 / 53504 FlyBaseID:FBgn0040253 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_973885.1 Gene:UGT85A5 / 838844 AraportID:AT1G22370 Length:479 Species:Arabidopsis thaliana


Alignment Length:440 Identity:89/440 - (20%)
Similarity:166/440 - (37%) Gaps:130/440 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PVPSHSHYYHALPYLKNLASLGHEITSVSP------------------------------FPSE- 61
            |.|:..|....|...|.|.:.|..:|.|:.                              .|.| 
plant    18 PFPAQGHINPMLKVAKLLYARGFHVTFVNTNYNHNRLIRSRGPNSLDGLPSFRFESIPDGLPEEN 82

  Fly    62 ----EPVKNIYDIYVPEVLNSFDELLKQMTTPKNTWEFFDATNEFVYNITKDVFNNDGVRREILR 122
                :.|..:.:..:...|..|.|||:::.|.|:........::.|.:.|.|.....||.     
plant    83 KDVMQDVPTLCESTMKNCLAPFKELLRRINTTKDVPPVSCIVSDGVMSFTLDAAEELGVP----- 142

  Fly   123 PGKAQFDLIIVDIWKYDA--FYSLAAYFEAPIIGLAP----CGIDWKIDEMVGNPSPMSY-LQSP 180
                  |::   .|...|  |.:...::.....||:|    ..:|.||:.:   ||..:. |:..
plant   143 ------DVL---FWTPSACGFLAYLHFYRFIEKGLSPIKDESSLDTKINWI---PSMKNLGLKDI 195

  Fly   181 SSYLYNLDTFGGRVAHVVEVAISWFNWHWRYEQKHEALYKKYFPKIAETKPLSEISQDIALVLVN 245
            .|::        |..:..::.:::|        .|||                :.::..:.:::|
plant   196 PSFI--------RATNTEDIMLNFF--------VHEA----------------DRAKRASAIILN 228

  Fly   246 -----QHFTLGPPRPYVPNVIEVGGMH------IDEQ-------PKALAQDLE--DFIQGSGEHG 290
                 :|..:...:..:|.|..:|.:|      |||:       .....:::|  |::.....:.
plant   229 TFDSLEHDVVRSIQSIIPQVYTIGPLHLFVNRDIDEESDIGQIGTNMWREEMECLDWLDTKSPNS 293

  Fly   291 VIYFSLGTNVRTKNMVDDRKRILIEAFG--SLPQRVLWKFEDE----ELQDIPSNVLVR------ 343
            |:|.:.|:..     |...|:::..|:|  :..:..||....:    ::..:|.:.|:.      
plant   294 VVYVNFGSIT-----VMSAKQLVEFAWGLAATKKDFLWVIRPDLVAGDVPMLPPDFLIETANRRM 353

  Fly   344 --KWLPQQDLLAHPKVKLFITHGGMQSTIESIHYGKPMLGLPFFYDQFTN 391
              .|.||:.:|:||.|..|:||.|..||:||:..|.||:..|||.:|.||
plant   354 LASWCPQEKVLSHPAVGGFLTHSGWNSTLESLSGGVPMVCWPFFAEQQTN 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35E1NP_652622.3 egt 6..461 CDD:223071 89/440 (20%)
UDPGT 33..484 CDD:278624 87/435 (20%)
UGT85A5NP_973885.1 Glycosyltransferase_GTB-type 12..475 CDD:385653 89/440 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.