DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35E1 and UGT85A7

DIOPT Version :9

Sequence 1:NP_652622.3 Gene:Ugt35E1 / 53504 FlyBaseID:FBgn0040253 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_173652.1 Gene:UGT85A7 / 838841 AraportID:AT1G22340 Length:487 Species:Arabidopsis thaliana


Alignment Length:527 Identity:109/527 - (20%)
Similarity:188/527 - (35%) Gaps:170/527 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PVPSHSHYYHALPYLKNLASLGHEITSVSP------------------FPSEEPVKNIYD----- 69
            |.|:..|....|...|.|.:.|..:|.|:.                  |||.. .::|.|     
plant    18 PYPAQGHINPMLKVAKLLYAKGFHVTFVNTLYNHNRLLRSRGPNALDGFPSFR-FESIPDGLPET 81

  Fly    70 -----IYVPEV--------LNSFDELLKQMTTPKNTWEFFDATNEFVYNITKDVFNNDGVRREIL 121
                 .:.|.|        |..|.|:|:::....:........::.|.:.|.|.....||...| 
plant    82 DGDRTQHTPTVCMSIEKNCLAPFKEILRRINDKDDVPPVSCIVSDGVMSFTLDAAEELGVPEVI- 145

  Fly   122 RPGKAQFDLIIVDIWKYDA--FYSLAAYFEAPIIGLAPCGIDWKIDEMVGNPSPMSYLQSPSSYL 184
                         .|...|  |.::..::.....||:|    :| ||        ||:...    
plant   146 -------------FWTNSACGFMTILHFYLFIEKGLSP----FK-DE--------SYMSKE---- 180

  Fly   185 YNLDTFGGRVAHVVEVAISWFNWHWRYEQKHEALYKKYFPK-IAETKP--------LSEI--SQD 238
             :|||           .|.|.       ...:.|..|..|. |..|.|        :.|:  |:.
plant   181 -HLDT-----------VIDWI-------PSMKNLRLKDIPSYIRTTNPDNIMLNFLIREVERSKR 226

  Fly   239 IALVLVN-----QHFTLGPPRPYVPNVIEVGGMHI---DEQPKA----------LAQDLE--DFI 283
            .:.:::|     :|..:...:..:|.|..:|.:|:   :|..:|          ..:::|  |::
plant   227 ASAIILNTFDELEHDVIQSMQSILPPVYSIGPLHLLVKEEINEASEIGQMGLNLWREEMECLDWL 291

  Fly   284 QGSGEHGVIYFSLG--TNVRTKNMVD-------DRKRILI---------EAFGSLPQRVLWKFED 330
            .....:.|::.:.|  |.:..|.:.:       .||..|.         ||...|||..|.:..|
plant   292 DTKTPNSVLFVNFGCITVMSAKQLEEFAWGLAASRKEFLWVIRPNLVVGEAMVVLPQEFLAETID 356

  Fly   331 EELQDIPSNVLVRKWLPQQDLLAHPKVKLFITHGGMQSTIESIHYGKPMLGLPFFYDQFTNVDHI 395
            ..        ::..|.||:.:|:||.:..|:||.|..||:||:..|.||:..|.|.:|.||..  
plant   357 RR--------MLASWCPQEKVLSHPAIGGFLTHCGWNSTLESLAGGVPMICWPCFSEQPTNCK-- 411

  Fly   396 KKHGFC-------LSLNYHDMTSDELKATILQLL-------TEKRFEVTARIA--GARYR-DQPM 443
                ||       :.:. .|:..:|::..:.:|:       ..::.|...|:|  ..||: ...:
plant   412 ----FCCDEWGVGIEIG-KDVKREEVETVVRELMDGEKGKKLREKAEEWRRLAEEATRYKHGSSV 471

  Fly   444 KPLETAV 450
            ..|||.:
plant   472 MNLETLI 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35E1NP_652622.3 egt 6..461 CDD:223071 109/527 (21%)
UDPGT 33..484 CDD:278624 107/522 (20%)
UGT85A7NP_173652.1 Glycosyltransferase_GTB-type 12..481 CDD:385653 109/527 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.