DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35E1 and AT5G38040

DIOPT Version :9

Sequence 1:NP_652622.3 Gene:Ugt35E1 / 53504 FlyBaseID:FBgn0040253 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_198620.1 Gene:AT5G38040 / 833784 AraportID:AT5G38040 Length:449 Species:Arabidopsis thaliana


Alignment Length:499 Identity:108/499 - (21%)
Similarity:184/499 - (36%) Gaps:132/499 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 RILALFPVPSHSHYYHALPYLKNLASLGHEITSV-------------SPF-----PSEEPVKNIY 68
            |.:.|.|||:..|....:...|.|.|.|..||.|             |.|     |...||.::.
plant     9 RRVVLVPVPAQGHITPMIQLAKALHSKGFSITVVQTKFNYLNPSNDLSDFQFVTIPENLPVSDLK 73

  Fly    69 DI----YVPEVLN----SFDELLKQMTTPKNTWEFFDATNEFVYNITKDVFNNDGVRREILRPGK 125
            ::    ::.::.|    ||.:||.|:...:.........:||:|.:...| ....:|..||....
plant    74 NLGPGRFLIKLANECYVSFKDLLGQLLVNEEEEIACVIYDEFMYFVEVAV-KEFKLRNVILSTTS 137

  Fly   126 A-----QFDLIIVDIWKYDAFYSLAAYFEAPIIGLAPCGIDWKIDEMVGNPSPMSYLQSPSSYLY 185
            |     :|  ::.:::..|....|....|..:             |:|....|:.|...|||...
plant   138 ATAFVCRF--VMCELYAKDGLAQLKEGGEREV-------------ELVPELYPIRYKDLPSSVFA 187

  Fly   186 NLDT---------FGGRVAHVVEVAISWFNWHWRYEQKHEALYKKYFPKIAETKPLSEISQDIAL 241
            ::::         :.|..:.|:...:                      :..|...|..:.|::.:
plant   188 SVESSVELFKNTCYKGTASSVIINTV----------------------RCLEMSSLEWLQQELEI 230

  Fly   242 VLVNQHFTLGPPRPYVPNVIEVGGMHIDEQPKALAQDLEDFIQGSGEH---GVIYFSLG--TNVR 301
            .:    :::||..           |.:...|.:|.::.|..|:...:.   .|||.|||  |.:.
plant   231 PV----YSIGPLH-----------MVVSAPPTSLLEENESCIEWLNKQKPSSVIYISLGSFTLME 280

  Fly   302 TKNMVDDRKRILIEAFGSLPQRVLW----------KFEDEEL---QDIPSNVLVRKWLPQQDLLA 353
            ||.|::     :...|.|..|..||          :..:|||   ..|.....:.||.||:.:||
plant   281 TKEMLE-----MAYGFVSSNQHFLWVIRPGSICGSEISEEELLKKMVITDRGYIVKWAPQKQVLA 340

  Fly   354 HPKVKLFITHGGMQSTIESIHYGKPMLGLPFFYDQFTNVDHIK---KHGFCLSLNYH-------- 407
            |..|..|.:|.|..||:||:..|.|::..||..||..|..:::   |.|..:.....        
plant   341 HSAVGAFWSHCGWNSTLESLGEGVPLICRPFTTDQKGNARYLECVWKVGIQVEGELERGAIERAV 405

  Fly   408 -----DMTSDELKATILQLLTEKRFEVTARIAGARYRDQPMKPL 446
                 |...:|:|...|.|..:.:..|.|:.:..:..|..:|.|
plant   406 KRLMVDEEGEEMKRRALSLKEKLKASVLAQGSSHKSLDDFIKTL 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35E1NP_652622.3 egt 6..461 CDD:223071 108/499 (22%)
UDPGT 33..484 CDD:278624 103/488 (21%)
AT5G38040NP_198620.1 Glycosyltransferase_GTB-type 1..446 CDD:415824 106/494 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.