DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35E1 and AT5G03490

DIOPT Version :9

Sequence 1:NP_652622.3 Gene:Ugt35E1 / 53504 FlyBaseID:FBgn0040253 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_195969.1 Gene:AT5G03490 / 831823 AraportID:AT5G03490 Length:465 Species:Arabidopsis thaliana


Alignment Length:482 Identity:112/482 - (23%)
Similarity:171/482 - (35%) Gaps:124/482 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LALFPVPSHSHYY------HA----------------LPYLKNLASLGH--EITSV----SPFPS 60
            :.:||.|:..|..      |.                |.||..|.| .|  .:|||    .|.||
plant    20 IVVFPFPAQGHLLPLLDLTHQLCLRGFNVSVIVTPGNLTYLSPLLS-AHPSSVTSVVFPFPPHPS 83

  Fly    61 EEP-VKNIYDI----YVPEVLNSFDELLKQMTTPKNTWEFFDA--------TNEFVYNITKDVFN 112
            ..| |:|:.|:    .:|.:.:     |:|:..|...|  |.:        .::|....|.|:.|
plant    84 LSPGVENVKDVGNSGNLPIMAS-----LRQLREPIINW--FQSHPNPPIALISDFFLGWTHDLCN 141

  Fly   113 NDGVRR------EILRPGKAQFDLIIVDIWKYDAFYSLAAYFEAPIIGLAPCGIDWKIDEM---- 167
            ..|:.|      ........||....:|:.|......|.....|||         :|.:.:    
plant   142 QIGIPRFAFFSISFFLVSVLQFCFENIDLIKSTDPIHLLDLPRAPI---------FKEEHLPSIV 197

  Fly   168 ---VGNPSPMSYLQSPSSYLYNLDTFGGRVAHVVEVAISWFNWHWRYEQKHEALYKKYFPKIAET 229
               :..|||  .|:|...:..||.::|           |.||                       
plant   198 RRSLQTPSP--DLESIKDFSMNLLSYG-----------SVFN----------------------- 226

  Fly   230 KPLSEISQDIALVLVNQHFTLGPPRPYVPNVIEVGGMHIDEQPKALAQDLEDFIQGSGEHGVIYF 294
              .|||.:|..|..|.|.  :|..|.||...:...|..:.....::...|..::.||....|:|.
plant   227 --SSEILEDDYLQYVKQR--MGHDRVYVIGPLCSIGSGLKSNSGSVDPSLLSWLDGSPNGSVLYV 287

  Fly   295 SLGTNVRTKNMVDDRKRILIEAFGSLPQRVLWKFEDEELQD------IPSNVLVRKWLPQQDLLA 353
            ..|:.   |.:..|:...|.........|.:|..:.:.:.|      ....::||.|:.|..:|.
plant   288 CFGSQ---KALTKDQCDALALGLEKSMTRFVWVVKKDPIPDGFEDRVSGRGLVVRGWVSQLAVLR 349

  Fly   354 HPKVKLFITHGGMQSTIESIHYGKPMLGLPFFYDQFTNVDHIKKH-GFCLSLNYHDMT---SDEL 414
            |..|..|::|.|..|.:|.|..|..:||.|...|||.|...:.:| |..:.:.....|   ||||
plant   350 HVAVGGFLSHCGWNSVLEGITSGAVILGWPMEADQFVNARLLVEHLGVAVRVCEGGETVPDSDEL 414

  Fly   415 KATILQLLTEKRFEVTARIAGARYRDQ 441
            ...|.:.:.|...||.||....|.:.:
plant   415 GRVIAETMGEGGREVAARAEEIRRKTE 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35E1NP_652622.3 egt 6..461 CDD:223071 112/482 (23%)
UDPGT 33..484 CDD:278624 109/473 (23%)
AT5G03490NP_195969.1 Glycosyltransferase_GTB_type 19..460 CDD:299143 112/482 (23%)
YjiC 19..447 CDD:224732 112/482 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.