DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35E1 and UGT78D2

DIOPT Version :9

Sequence 1:NP_652622.3 Gene:Ugt35E1 / 53504 FlyBaseID:FBgn0040253 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_197207.1 Gene:UGT78D2 / 831568 AraportID:AT5G17050 Length:460 Species:Arabidopsis thaliana


Alignment Length:460 Identity:96/460 - (20%)
Similarity:159/460 - (34%) Gaps:163/460 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YLIILLFPGFLYGARILALFPVPSHSHYYHALPYLKNLASLGHEITSVSP--------------- 57
            ::.:|.||   :|.               ||.|    |.::...:.|.||               
plant    12 HVAVLAFP---FGT---------------HAAP----LLTVTRRLASASPSTVFSFFNTAQSNSS 54

  Fly    58 -FPSEEPVKNIYDIYVPEVLNSFDELLKQMTTPKNTWE-FFDATNEFVYNITKDVFNNDGVRREI 120
             |.|.:......:|.|.::.:...|.......|:...| |..|..|             ..||||
plant    55 LFSSGDEADRPANIRVYDIADGVPEGYVFSGRPQEAIELFLQAAPE-------------NFRREI 106

  Fly   121 LRPGKAQFDL------IIVD--IW-----------KYDAFY-----SLAAYFEAPI----IGLAP 157
               .||:.::      ::.|  .|           .:.||:     ||:|:....:    ||:..
plant   107 ---AKAETEVGTEVKCLMTDAFFWFAADMATEINASWIAFWTAGANSLSAHLYTDLIRETIGVKE 168

  Fly   158 CGIDWKIDEMVGNPSPMSYLQ---SPSSYLY-NLDTFGGRVAHVVEVAISWFNWHWRYEQKHEAL 218
            .|  .:::|.:|..|.|..::   :|...:: |||:...::.|.:.:|:          .:..|:
plant   169 VG--ERMEETIGVISGMEKIRVKDTPEGVVFGNLDSVFSKMLHQMGLAL----------PRATAV 221

  Fly   219 YKKYFPKIAETKPLSEISQDIALVLVN-------QHFTLGPPRPYVPNVIEVGGMHIDEQPKALA 276
            :...|             :|:...|.|       ::..:||          :|         .|:
plant   222 FINSF-------------EDLDPTLTNNLRSRFKRYLNIGP----------LG---------LLS 254

  Fly   277 QDLEDFIQGSGEHG------------VIYFSLGTNVRTKNMVDDRKRILIEAFGSLPQRVLWKFE 329
            ..|:..:|  ..||            |.|.|.|| |.|.  .......:.|...|.....:|..:
plant   255 STLQQLVQ--DPHGCLAWMEKRSSGSVAYISFGT-VMTP--PPGELAAIAEGLESSKVPFVWSLK 314

  Fly   330 DEELQDIPSNVLVR--------KWLPQQDLLAHPKVKLFITHGGMQSTIESIHYGKPMLGLPFFY 386
            ::.|..:|...|.|        .|.||.:||.|....:|:||.|..|.:||:..|.||:..|||.
plant   315 EKSLVQLPKGFLDRTREQGIVVPWAPQVELLKHEATGVFVTHCGWNSVLESVSGGVPMICRPFFG 379

  Fly   387 DQFTN 391
            ||..|
plant   380 DQRLN 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35E1NP_652622.3 egt 6..461 CDD:223071 96/460 (21%)
UDPGT 33..484 CDD:278624 92/435 (21%)
UGT78D2NP_197207.1 GT1_Gtf-like 12..438 CDD:340817 96/460 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.