DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35E1 and AT5G17040

DIOPT Version :9

Sequence 1:NP_652622.3 Gene:Ugt35E1 / 53504 FlyBaseID:FBgn0040253 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_197206.2 Gene:AT5G17040 / 831567 AraportID:AT5G17040 Length:442 Species:Arabidopsis thaliana


Alignment Length:290 Identity:58/290 - (20%)
Similarity:121/290 - (41%) Gaps:56/290 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 EMVGNPSPMSYLQ---SPSSYLY-NLDTFGGRVAHVVEVAISWFNWHWRYEQKHEALYKKYFPKI 226
            |.:|..|.|..::   :|...:: |||:...::.|.:.:|:          .:...:|...|.::
plant   156 ETLGCISGMEKIRVKDTPEGVVFGNLDSVFSKMLHQMGLAL----------PRATTVYMNSFEEL 210

  Fly   227 AETKPLSEISQDIALVLVNQHFTLGPPRPYVPNVIEVGGMHIDEQPKALAQDLED---FIQGSGE 288
            ..|     ::.::.|.. .::.::||          :..:....|.:....|...   :|:....
plant   211 DPT-----LTDNLRLKF-KRYLSIGP----------LALLFSTSQRETPLHDPHGCLAWIKKRST 259

  Fly   289 HGVIYFSLGTNVRTKNMVDDRKRILIEAFGSLPQRV--LWKFEDEELQDIPSNVL--------VR 343
            ..|:|.:.|     :.|......:::.|.|....:|  :|..:::.:..:|...|        |.
plant   260 ASVVYIAFG-----RVMTPPPGELVVVAQGLESSKVPFVWSLQEKNMVHLPKGFLDGTREQGMVV 319

  Fly   344 KWLPQQDLLAHPKVKLFITHGGMQSTIESIHYGKPMLGLPFFYDQFTN---VDHIKKHGFCLSLN 405
            .|.||.:||.|..:.:|::|||..|.:||:..|.||:..|.|.|...|   |:.:.:.|..:|..
plant   320 PWAPQVELLNHEAMGVFVSHGGWNSVLESVSAGVPMICRPIFGDHALNARSVEAVWEIGMTISSG 384

  Fly   406 YHDMTSDELKATILQLLTE---KRFEVTAR 432
            .  .|.|..:.::.::|.:   |:.:..|:
plant   385 V--FTKDGFEESLDRVLVQDDGKKMKFNAK 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35E1NP_652622.3 egt 6..461 CDD:223071 58/290 (20%)
UDPGT 33..484 CDD:278624 58/290 (20%)
AT5G17040NP_197206.2 Glycosyltransferase_GTB_type 2..428 CDD:299143 58/290 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.