DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35E1 and UGT78D3

DIOPT Version :9

Sequence 1:NP_652622.3 Gene:Ugt35E1 / 53504 FlyBaseID:FBgn0040253 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_197205.1 Gene:UGT78D3 / 831566 AraportID:AT5G17030 Length:459 Species:Arabidopsis thaliana


Alignment Length:491 Identity:102/491 - (20%)
Similarity:181/491 - (36%) Gaps:140/491 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YLIILLFPGFLYGARILAL---FPVPSHSHYYHALPYLKNLASLGHEITSVSPFPSEEPVKNIYD 69
            ::.:|:||...:.|.:||:   ....:.|..:......::.:||     ..|..|:...|.|: |
plant    12 HVAVLVFPFGTHAAPLLAVTCRLATAAPSTVFSFFSTARSNSSL-----LSSDIPTNIRVHNV-D 70

  Fly    70 IYVPE--VLNSFDELLKQMTTPKNTWEFFDATNEFVYNITKDVFNNDGVRREILRPGKA------ 126
            ..|||  ||..         .|::..|.|       .....::|     ||||    ||      
plant    71 DGVPEGFVLTG---------NPQHAVELF-------LEAAPEIF-----RREI----KAAETEVG 110

  Fly   127 -QFDLIIVD--IW------------KYDAFY-----SLAAYFEAPII----GLAPCGIDWKIDEM 167
             :|..|:.|  :|            .:.|:|     ||.|:.....|    |:...|  .:::|.
plant   111 RKFKCILTDAFLWLAAETAAAEMKASWVAYYGGGATSLTAHLYTDAIRENVGVKEVG--ERMEET 173

  Fly   168 VGNPSPMSYLQSPSS----YLYNLDTFGGRVAHVVEVAISWFNWHWRYEQKHEALYKKYFPKIAE 228
            :|..|.|..::...:    ...|||:...:..|.:.:|:                     |:   
plant   174 IGFISGMEKIRVKDTQEGVVFGNLDSVFSKTLHQMGLAL---------------------PR--- 214

  Fly   229 TKPLSEISQDIALVLVNQHFTLGPP-----RPYVPNVIEVGGMHIDEQPKALAQDLED------F 282
                      ...|.:|....|.|.     |......:.:|.:.:...|...:..:.|      :
plant   215 ----------ATAVFINSFEELDPTFTNDFRSEFKRYLNIGPLALLSSPSQTSTLVHDPHGCLAW 269

  Fly   283 IQGSGEHGVIYFSLGTNVRTKNMVDDRKRILIEAFGSLPQRV--LWKFEDEELQDIPSNVLVR-- 343
            |:......|.|.:.| .|.|...|:    ::..|.|....:|  :|..::.::..:|...|.|  
plant   270 IEKRSTASVAYIAFG-RVATPPPVE----LVAIAQGLESSKVPFVWSLQEMKMTHLPEGFLDRTR 329

  Fly   344 ------KWLPQQDLLAHPKVKLFITHGGMQSTIESIHYGKPMLGLPFFYDQFTN---VDHIKKHG 399
                  .|.||.:||.|..:.:|::|||..|.:||:..|.||:..|.|.|...|   |:.:.:.|
plant   330 EQGMVVPWAPQVELLNHEAMGVFVSHGGWNSVLESVSAGVPMICRPIFGDHAINARSVEAVWEIG 394

  Fly   400 FCLSLNYHDMTSDELKATILQLLTE---KRFEVTAR 432
            ..:|...  .|.|..:.::.::|.:   |:.:|.|:
plant   395 VTISSGV--FTKDGFEESLDRVLVQDDGKKMKVNAK 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35E1NP_652622.3 egt 6..461 CDD:223071 102/491 (21%)
UDPGT 33..484 CDD:278624 96/463 (21%)
UGT78D3NP_197205.1 Glycosyltransferase_GTB_type 6..458 CDD:299143 102/491 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.