DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35E1 and AT5G05880

DIOPT Version :9

Sequence 1:NP_652622.3 Gene:Ugt35E1 / 53504 FlyBaseID:FBgn0040253 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_196207.1 Gene:AT5G05880 / 830473 AraportID:AT5G05880 Length:451 Species:Arabidopsis thaliana


Alignment Length:378 Identity:88/378 - (23%)
Similarity:131/378 - (34%) Gaps:116/378 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 ELLKQMTTPKNTWEFFDATNEFVYNITKD---VFNNDGVRRE-----ILRPGKAQFDLIIVDIWK 137
            :|.::|..|....|..|...:|.....||   :...|.|:.:     ||...||...||.:...:
plant   149 QLRREMFLPLQDSEQDDPVEKFPPLRKKDLLRILEADSVQGDSYSDMILEKTKASSGLIFMSCEE 213

  Fly   138 --YDAFYSLAAYFEAPIIGLAPCGIDWKIDEMVGNPSPMSYLQSPSSYLYNLDTFGGRVAHVVEV 200
              .|:.......|:.||..:.|               ..|:..:.||.|:..|          |.
plant   214 LDQDSLSQSREDFKVPIFAIGP---------------SHSHFPASSSSLFTPD----------ET 253

  Fly   201 AISWFNWHWRYEQKHEALYKKYFPKIAETKPLSEIS-QDIALVLVNQHFTLGPPRPYVPNVIEVG 264
            .|.|.:   |.|.|     ...:..|.....::|.. .:||..|.|.      .:|:: .|:.||
plant   254 CIPWLD---RQEDK-----SVIYVSIGSLVTINETELMEIAWGLSNS------DQPFL-WVVRVG 303

  Fly   265 GMHIDEQPKALAQDLEDFIQGSGEHGVIYFSLGTNVRTKNMVDDRKRILIEAFGSLPQRVLWKFE 329
            .::..|..:|:.   |.||:...|.|.|.                                    
plant   304 SVNGTEWIEAIP---EYFIKRLNEKGKIV------------------------------------ 329

  Fly   330 DEELQDIPSNVLVRKWLPQQDLLAHPKVKLFITHGGMQSTIESIHYGKPMLGLPFFYDQFTN--- 391
                          ||.|||::|.|..:..|:||.|..||:||:..|.||:.|||.:||..|   
plant   330 --------------KWAPQQEVLKHRAIGGFLTHNGWNSTVESVCEGVPMICLPFRWDQLLNARF 380

  Fly   392 VDHIKKHGFCLSLNYHDMTSDELKATILQLLTEKRFEVTARIAGARYRDQPMK 444
            |..:...|..|.   ..:..||::..|.:||.|...|      ..|.|.|.:|
plant   381 VSDVWMVGIHLE---GRIERDEIERAIRRLLLETEGE------AIRERIQLLK 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35E1NP_652622.3 egt 6..461 CDD:223071 88/378 (23%)
UDPGT 33..484 CDD:278624 88/378 (23%)
AT5G05880NP_196207.1 Glycosyltransferase_GTB-type 2..451 CDD:385653 88/378 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.